[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54029.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:91 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   4->62 PF04956 * TrbC 3.2e-05 23.6 55/100  
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54029.1 GT:GENE BAF54029.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1161477..1161752 GB:FROM 1161477 GB:TO 1161752 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54029.1 LENGTH 91 SQ:AASEQ MKTRHRTLFACVAAVSLVASPGLAPTANAQDRAPTSTEIAVNSTYGLLDNPITAPIGLFILLSSMTWHFLIWCPIGQSSGFIDPYSGECTF GT:EXON 1|1-91:0| TM:NTM 2 TM:REGION 6->28| TM:REGION 54->76| HM:PFM:NREP 1 HM:PFM:REP 4->62|PF04956|3.2e-05|23.6|55/100|TrbC| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ---------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccHHHHHHHHHHHHHHHHHccccccccccccccccccEEEEEcccccccccccHHHHHHHHHHHccEEEEEEEEccccccccccccccccc //