[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54034.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:164 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   146->164 PF05901 * Excalibur 4e-04 84.2 %
:HMM:PFM   128->164 PF05901 * Excalibur 1.1e-17 43.2 37/37  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54034.1 GT:GENE BAF54034.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1167551..1168045) GB:FROM 1167551 GB:TO 1168045 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54034.1 LENGTH 164 SQ:AASEQ MSFPNLKYSIKGSTDSSGRMKRLALIGSSLIISMGLITACGSANAEPETPTPTVTETVTSTKTTTVKASTITTTVTETAPAEDLGQEAVEPAAVEEYSEPQVNVPQQFAAIPDPAPAVAPAPAPAPAYYANCAAARAAGAAPIYAGSPGYSSKLDRDGDGIACE GT:EXON 1|1-164:0| SEG 23->37|laligssliismgli| SEG 45->81|aepetptptvtetvtstktttvkastitttvtetapa| SEG 109->145|aaipdpapavapapapapayyancaaaraagaapiya| RP:PFM:NREP 1 RP:PFM:REP 146->164|PF05901|4e-04|84.2|19/37|Excalibur| HM:PFM:NREP 1 HM:PFM:REP 128->164|PF05901|1.1e-17|43.2|37/37|Excalibur| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,8-17,46-51,106-107,109-122,158-158,163-165| PSIPRED cccccccccccccccccccEEHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEEcccccccccccccccHHHHHHHHccHHHHHHHcccccccccEEcccccccccccccccccccccccHHHHHHHHccccccccccHHHHccccccccccc //