[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54043.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  518/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.204.1
:195 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   86->164 3crcA PDBj 5e-15 39.2 %
:RPS:PDB   67->186 3crcA PDBj 2e-23 28.6 %
:RPS:SCOP  86->149 1y6xA1  a.204.1.4 * 7e-13 16.7 %
:HMM:SCOP  61->164 2a3qA1 a.204.1.2 * 1.3e-14 29.0 %
:HMM:PFM   90->163 PF03819 * MazG 8.7e-29 48.6 74/74  
:BLT:SWISS 86->191 YABN_BACSU 4e-18 43.8 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54043.1 GT:GENE BAF54043.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1182170..1182757 GB:FROM 1182170 GB:TO 1182757 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54043.1 LENGTH 195 SQ:AASEQ MRVVVVDPKHPVLPVSFLEAVLGRGEPVSIDPDFPFDIEKWGIKTSTSASWFITAKPQSTLLIDAPLNPLHEAVGVMRAAVGRGEWERTQTHESLIPYLEEESQEFIEAIHGGDDEHMKSELGDVLLQVLFHAEIAARQGRFDIFDVAASFVAKMQSRSPYLFDGSTGIVDTDEQQRLWAQGKAQEKLSSEKGRR GT:EXON 1|1-195:0| BL:SWS:NREP 1 BL:SWS:REP 86->191|YABN_BACSU|4e-18|43.8|105/489| BL:PDB:NREP 1 BL:PDB:REP 86->164|3crcA|5e-15|39.2|79/225| RP:PDB:NREP 1 RP:PDB:REP 67->186|3crcA|2e-23|28.6|119/225| HM:PFM:NREP 1 HM:PFM:REP 90->163|PF03819|8.7e-29|48.6|74/74|MazG| RP:SCP:NREP 1 RP:SCP:REP 86->149|1y6xA1|7e-13|16.7|60/87|a.204.1.4| HM:SCP:REP 61->164|2a3qA1|1.3e-14|29.0|100/0|a.204.1.2|1/1|all-alpha NTP pyrophosphatases| OP:NHOMO 522 OP:NHOMOORG 518 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11--211111121111111111111--111111-1--1--1111111-1-1----111-111-111111111-111----1111111111-------1--1111-11-11111111111--11111111111121111111111--1111111111111111111111111-111111111111111111-11111111111-11------1111111111111111111111----------------------------------------------------------------------11111111111111111111111111--1--11111111-1-11111---11-1111-11-111---11------------------11-1111-111-------------1111111--1---11--------11111111------------------------------11111-----------------------------------------------------------------------111111111-1111-1111111111111111----------------------------111111111111111111----1----1-1----111------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111---1---------111111111111111111111111111111111111111111111-111----------11111111111111--1-1--1111111--11111111------------------------------------11-1111111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 155 STR:RPRED 79.5 SQ:SECSTR ############################EEcccccEEEEEEEcccE###EEEEEcccEEEEEEcccHHHHHHHHHHHHccccccTTTTcccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHT######### DISOP:02AL 180-196| PSIPRED cEEEEEccccccccEEHHEEccccccEEEEEccccccHHHHcccccccccEEEEEccHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHcc //