[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54051.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:56 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   37->48 PF06462 * Hyd_WA 0.00062 58.3 12/32  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54051.1 GT:GENE BAF54051.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1189123..1189293 GB:FROM 1189123 GB:TO 1189293 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54051.1 LENGTH 56 SQ:AASEQ MPVADGEKYTHSLFEDDENYSTPLPIGFSLTSGEPLEDGSVWMRYGVNGPVDAATP GT:EXON 1|1-56:0| HM:PFM:NREP 1 HM:PFM:REP 37->48|PF06462|0.00062|58.3|12/32|Hyd_WA| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- --------111-----------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7,52-57| PSIPRED cccccccccccEEEEccccccccccccEEEEEEEEcccccEEEEEEcccccccccc //