Corynebacterium glutamicum R (cglu2)
Gene : BAF54056.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  30/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:161 amino acids
:HMM:PFM   42->73 PF03748 * FliL 0.00044 21.9 32/149  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54056.1 GT:GENE BAF54056.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1192982..1193467) GB:FROM 1192982 GB:TO 1193467 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54056.1 LENGTH 161 SQ:AASEQ MSTNSNSPSNASGASNIPNTQRPASRYNSPRPEAAAGRNISGKIIAVIGVLLVIAIVIVGANFLKNRDAQTVSGQMGSFERIDDDTFRFEVDVTRDDPSQVAYCIVTAKDYSHAEVGRREVLVEPSDHSTVRISTLIPTREPAVSGGVYGCSTVIPSHMNL GT:EXON 1|1-161:0| TM:NTM 1 TM:REGION 42->64| SEG 4->19|nsnspsnasgasnipn| SEG 44->61|iiavigvllviaivivga| HM:PFM:NREP 1 HM:PFM:REP 42->73|PF03748|0.00044|21.9|32/149|FliL| OP:NHOMO 30 OP:NHOMOORG 30 OP:PATTERN -------------------------------------------------------------------- -----11111111111111-111111111111-----111------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-35| PSIPRED cccccccccccccccccccccccHHHHcccccHHcccccccccEEEEEHHHHHHHEEEEcccHHccccccEEEEEEEEEEEEcccEEEEEEEEEcccccccEEEEEEEEcccccEEccEEEEEccccccEEEEEEEEEccccccccEEEcccccccHHHcc //