[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54073.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  303/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.4.5a.78.1
:217 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   19->206 2hs5A PDBj 9e-27 40.2 %
:RPS:PDB   2->216 3c7jA PDBj 6e-23 22.8 %
:RPS:SCOP  11->85 3bwgA1  a.4.5.6 * 1e-15 22.7 %
:RPS:SCOP  76->214 2hs5A2  a.78.1.1 * 3e-10 31.1 %
:HMM:SCOP  1->109 1v4rA1 a.4.5.6 * 2.6e-16 41.7 %
:RPS:PFM   22->69 PF00392 * GntR 9e-11 66.7 %
:RPS:PFM   79->205 PF07729 * FCD 8e-04 27.2 %
:HMM:PFM   10->69 PF00392 * GntR 2.4e-20 46.7 60/64  
:HMM:PFM   79->203 PF07729 * FCD 2.5e-13 24.6 122/125  
:HMM:PFM   61->91 PF06416 * DUF1076 0.00032 35.5 31/113  
:BLT:SWISS 1->143 YTUX_AGRVI 1e-12 30.1 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54073.1 GT:GENE BAF54073.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1208648..1209301 GB:FROM 1208648 GB:TO 1209301 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54073.1 LENGTH 217 SQ:AASEQ MTQAIAASLDLAARITAKIDQGELTPGTRLPEVALAEELGVSRNTLREAFRVLMQDGLVDHIPNRGVFVHTFTKSDVEDIYAYRAFIEVAAIRSARKNPQLLEQSLGVMREAYERGAAANAVGDWQTVGSANSAFHLAIVDLAGVARLSADARKVLALARIGFMATYNVETFHSIYVEKNHQILKYLAAGEFEEAEQYLQKYFEDSRDDLSAHLPEF GT:EXON 1|1-217:0| BL:SWS:NREP 1 BL:SWS:REP 1->143|YTUX_AGRVI|1e-12|30.1|143/171| BL:PDB:NREP 1 BL:PDB:REP 19->206|2hs5A|9e-27|40.2|179/205| RP:PDB:NREP 1 RP:PDB:REP 2->216|3c7jA|6e-23|22.8|206/232| RP:PFM:NREP 2 RP:PFM:REP 22->69|PF00392|9e-11|66.7|48/64|GntR| RP:PFM:REP 79->205|PF07729|8e-04|27.2|125/125|FCD| HM:PFM:NREP 3 HM:PFM:REP 10->69|PF00392|2.4e-20|46.7|60/64|GntR| HM:PFM:REP 79->203|PF07729|2.5e-13|24.6|122/125|FCD| HM:PFM:REP 61->91|PF06416|0.00032|35.5|31/113|DUF1076| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00392|IPR000524| GO:PFM GO:0005622|"GO:intracellular"|PF00392|IPR000524| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00392|IPR000524| RP:SCP:NREP 2 RP:SCP:REP 11->85|3bwgA1|1e-15|22.7|75/78|a.4.5.6| RP:SCP:REP 76->214|2hs5A2|3e-10|31.1|135/138|a.78.1.1| HM:SCP:REP 1->109|1v4rA1|2.6e-16|41.7|96/0|a.4.5.6|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 777 OP:NHOMOORG 305 OP:PATTERN ------1------------------------------------------------------------- --1-21-11121-12------1--18-----1111131B7-1-25211111-367121----6-318232------------3-----------------------------------------------------12222----1-------------------------------------1--11---1-1---------------3-1111-----1-1--------14---------------1---1----------------------------------------------------------------------2111-----------2211----1-2---1312112211-112---2-----11--------22713--31-11-33233333229-33633934451-C7784487267754-113372-44112--------311----1--------------------------------4--1433754444411111669C32113152E8CB512--13242283F286121----1-1111111---211--2---1---2----1111111-1-------2---------------------1-------2--11-1-111111---1111-1--11-----1----------31--------------------------------1111---111-11111111111111------------------------------------2-33---------------11111-31--3-22422223454551544-------------1------------11-11-----------------------------------------------------------1------ --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 217 STR:RPRED 100.0 SQ:SECSTR cccGGGHHHHHHHHHHHHHHTccccTTccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEETTTEEEEcccHHHHHHHHHHHHHHHHHHHHHHHGHcGGccHHHHHHHHHHHHHHHHcccHHHHHcHHHHHHHHHHHHTTTcccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHHHHHHc DISOP:02AL 1-4| PSIPRED ccccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHccccHHHHHHHHHHHHcccEEEEccccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccc //