[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54077.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:76 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   27->65 PF10763 * DUF2584 0.001 17.9 39/80  
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54077.1 GT:GENE BAF54077.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1212990..1213220 GB:FROM 1212990 GB:TO 1213220 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54077.1 LENGTH 76 SQ:AASEQ MERFMVGAEAFLLLGIKWFASSFLAHDSHVIDKGSGVRVFDCSFKLHSVQFLLFCCEIICPVAEVQPHKFNQCVIG GT:EXON 1|1-76:0| TM:NTM 2 TM:REGION 8->30| TM:REGION 46->68| HM:PFM:NREP 1 HM:PFM:REP 27->65|PF10763|0.001|17.9|39/80|DUF2584| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED ccEEEEcHHHHHHHHHHHHHHHHHHHcccEEEccccEEEEEEEEEHHHHHHHHHHHHHHccHHHcccccccccccc //