[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54078.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:153 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54078.1 GT:GENE BAF54078.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1213241..1213702) GB:FROM 1213241 GB:TO 1213702 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54078.1 LENGTH 153 SQ:AASEQ MELSVHTPLEEFHQILTRLRIQLLAEHAHRSTPSPAWTPTTPGLFTYDDEAFSGVIIRKFPSSTTSERWLIIGSDWEEISAFQSKEKGHLHISPAAPEWTGLVSLEDFYPYRGSVIGDAPSSVTWFEDGIWHVSEERNNGTPSIPTDPGPTNP GT:EXON 1|1-153:0| SEG 31->42|stpspawtpttp| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,140-140,142-154| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEccccccEEEEEEccccccccEEEEEcccHHHccHHHccccccEEEcccccccEEEEEHHHccccccccccccccccEEEEccEEEEcccccccccccccccccccc //