[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54081.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  28/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:190 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   121->141 PF10733 * DUF2525 0.00064 40.0 20/58  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54081.1 GT:GENE BAF54081.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1215747..1216319 GB:FROM 1215747 GB:TO 1216319 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54081.1 LENGTH 190 SQ:AASEQ MAEKRPKIFDGSRDMIISLVVSAIIMLVAVGFTGMCSFNTGSPENGQVPEVDASTFMSMEARAMTDHATRLPETPEGWTTNSARRTMVDDTPASVVGYVTADEGYIQLTQTGETVEDAVAGYDTRWRDLSDSYDLDGHDVGIYTSQESDVRDLRVMDLGDARVMVSGAATDEEFNDLLRAVADSEPLPVS GT:EXON 1|1-190:0| HM:PFM:NREP 1 HM:PFM:REP 121->141|PF10733|0.00064|40.0|20/58|DUF2525| OP:NHOMO 28 OP:NHOMOORG 28 OP:PATTERN -------------------------------------------------------------------- -----1111111111--11-111111111111----1111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,188-191| PSIPRED cccccccccccccccHHHHcHHHHHHHHHcccccEEEEccccccccccccccHHHHHHHHHHHccccccccccccccEEcccccccccccccccEEEEEcccccEEEEEEccccHHHHHHccccccccccccEEEccEEEEEEccccccEEEEEEEcccccEEEEEccccHHHHHHHHHHcccccccccc //