[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54084.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  78/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.7.13
:81 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   24->74 1vp7E PDBj 4e-04 38.0 %
:RPS:SCOP  20->81 1vp7A  a.7.13.1 * 5e-10 30.6 %
:HMM:SCOP  14->83 1vp7B_ a.7.13.1 * 2e-13 41.4 %
:RPS:PFM   24->75 PF02609 * Exonuc_VII_S 3e-04 48.1 %
:HMM:PFM   24->75 PF02609 * Exonuc_VII_S 1.3e-18 44.2 52/53  
:BLT:SWISS 5->79 EX7S_CORDI 2e-29 73.3 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54084.1 GT:GENE BAF54084.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1218206..1218451) GB:FROM 1218206 GB:TO 1218451 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54084.1 LENGTH 81 SQ:AASEQ MTNPDIVGSGQGNDSFEPVAQLSYERARDELVEIVKILELGQMGLDESLKYWERGEALAKRCEEHLAGASARVEQALNQAE GT:EXON 1|1-81:0| BL:SWS:NREP 1 BL:SWS:REP 5->79|EX7S_CORDI|2e-29|73.3|75/85| BL:PDB:NREP 1 BL:PDB:REP 24->74|1vp7E|4e-04|38.0|50/66| RP:PFM:NREP 1 RP:PFM:REP 24->75|PF02609|3e-04|48.1|52/53|Exonuc_VII_S| HM:PFM:NREP 1 HM:PFM:REP 24->75|PF02609|1.3e-18|44.2|52/53|Exonuc_VII_S| GO:PFM:NREP 3 GO:PFM GO:0006308|"GO:DNA catabolic process"|PF02609|IPR003761| GO:PFM GO:0008855|"GO:exodeoxyribonuclease VII activity"|PF02609|IPR003761| GO:PFM GO:0009318|"GO:exodeoxyribonuclease VII complex"|PF02609|IPR003761| RP:SCP:NREP 1 RP:SCP:REP 20->81|1vp7A|5e-10|30.6|62/68|a.7.13.1| HM:SCP:REP 14->83|1vp7B_|2e-13|41.4|70/0|a.7.13.1|1/1|XseB-like| OP:NHOMO 78 OP:NHOMOORG 78 OP:PATTERN -------------------------------------------------------------------- ----11111111-111111-11111111111111111111----111111111111-1-----11111----111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1111-111111----------------------------11111111----------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 50 STR:RPRED 61.7 SQ:SECSTR #######################HHHHHHHHHHHHHH#HTccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH####### DISOP:02AL 1-2,79-82| PSIPRED ccccHHccccccccccccHHHccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //