[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54085.1
DDBJ      :             hypothetical protein
Swiss-Prot:EX7L_CORGB   RecName: Full=Exodeoxyribonuclease 7 large subunit;         EC=3.1.11.6;AltName: Full=Exodeoxyribonuclease VII large subunit;         Short=Exonuclease VII large subunit;

Homologs  Archaea  15/68 : Bacteria  817/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.23.4
:417 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   67->260 2a8lA PDBj 3e-24 12.6 %
:RPS:SCOP  132->272 1cqiB1  c.23.4.1 * 5e-11 20.8 %
:RPS:PFM   134->408 PF02601 * Exonuc_VII_L 7e-39 46.2 %
:HMM:PFM   134->353 PF02601 * Exonuc_VII_L 7.5e-65 36.4 220/319  
:HMM:PFM   350->408 PF02601 * Exonuc_VII_L 2.7e-06 31.5 54/319  
:HMM:PFM   36->112 PF01336 * tRNA_anti 1.6e-06 27.0 74/76  
:BLT:SWISS 1->417 EX7L_CORGB 0.0 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54085.1 GT:GENE BAF54085.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1218472..1219725) GB:FROM 1218472 GB:TO 1219725 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54085.1 LENGTH 417 SQ:AASEQ MSSEKASSKSTPEAPWPVREVNTQVKQWIERLGHLWVEGQLAQINVKPNWKLSYLTLRDVEQEVSVQLTCPTDIIRNRPTPLKDGDRVIVYGKPAFYAGRGTFSLWVTDIRPVGIGELLARIEELRKRLAAEGLFDPARKKRLPFLPNRVGLITGRGSAAERDVLSVAKDRWPEVQFEVINTAVQGASAVPEIIEALRALDQDPRVDVIIIARGGGSVEDLLPFSEEALQRAVAAAQTPVVSAIGHEPDTPVLDNVADLRAATPTDAAKRVVPDVAEERMLINQLRSRSAAALRGWVQREQQALAAIRTRPVLADPMTPINRRRDEIAQAVGLIRRDVTHLVRTEQALVASLRAQVSALGPSATLARGYSVVQVIPRDGSAPEVVTTIEQSPPGSQLRIRVADGSITAASMGTQQAN GT:EXON 1|1-417:0| SW:ID EX7L_CORGB SW:DE RecName: Full=Exodeoxyribonuclease 7 large subunit; EC=3.1.11.6;AltName: Full=Exodeoxyribonuclease VII large subunit; Short=Exonuclease VII large subunit; SW:GN Name=xseA; OrderedLocusNames=cgR_1108; SW:KW Complete proteome; Cytoplasm; Exonuclease; Hydrolase; Nuclease. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->417|EX7L_CORGB|0.0|100.0|417/417| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0004527|"GO:exonuclease activity"|Exonuclease| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0004518|"GO:nuclease activity"|Nuclease| RP:PDB:NREP 1 RP:PDB:REP 67->260|2a8lA|3e-24|12.6|182/307| RP:PFM:NREP 1 RP:PFM:REP 134->408|PF02601|7e-39|46.2|266/313|Exonuc_VII_L| HM:PFM:NREP 3 HM:PFM:REP 134->353|PF02601|7.5e-65|36.4|220/319|Exonuc_VII_L| HM:PFM:REP 350->408|PF02601|2.7e-06|31.5|54/319|Exonuc_VII_L| HM:PFM:REP 36->112|PF01336|1.6e-06|27.0|74/76|tRNA_anti| RP:SCP:NREP 1 RP:SCP:REP 132->272|1cqiB1|5e-11|20.8|130/147|c.23.4.1| OP:NHOMO 844 OP:NHOMOORG 834 OP:PATTERN ------------------------2---1---1-----111111111111------------------ 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111------1111-111---------11-111111111111111111111111111111111---111111-1-1111111111----111--111---1-11-111----111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111--111111111111111-----111111111111111111111111111111112111111111111111121111111111111111111111111111111111111111111121111311111211111111111111111112111111111111112111111111111111111111111---1111------111111111111111-1-1111111111111111111111111111111111111111111111111111-111111111111--11111111111111111-1111-11111111111111-111111111111111111111111111111111111111111111111111111111111111-111111--------1-1----1---1-1------1-------11--111111111 --------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------1---------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 391 STR:RPRED 93.8 SQ:SECSTR ################cGGGccccEEEEEEEEEEEEEEEEEEc#TTccEEEEEEEEEEE##TTEEEccccccEEEHHHHHHHHTTcccccEEEEEEETTccEEEEEEEEEEEEcccTTccTTcccGGGcTTTcEEEGGGEcccTTcccEEEEEEEEcHHHHHHTHHTHHHHHHHHTTcccHHHHHHHHHHHTTTTcGGGTTcccccEEEEEEEEccEEEEEEEEcccEEEEEEEETTccTTccTTTccEGcEEEEEEEccEEEEEEEEccccEEEEEHHHHHTccHHHHHHHHHHHHHHHHHHHHcccccccccGGGccccccHHHHHHHHHHHHHHHHHHHTTEEHHHHHHHHHHHHHcccccccccccHHccccccccHHHHTcEEEEcTTccEEEGGGEEEEEEEcc####### DISOP:02AL 1-16,414-418| PSIPRED cccccccccccccccEEHHHHHHHHHHHHHccccEEEEEEEEccEEcccccEEEEEEEccccEEEEEEEEEccHHHHcccccccccEEEEEEEEEEEEcccEEEEEEEEEEEccHHHHHHHHHHHHHHHHHcccccHHHcccccccccEEEEEccccHHHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHcccHHHHHHHHcccccEEEEEcccccHHHHHHHHcccccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHccEEEEEEcccccccccEEccHHHcccccEEEEEEEccEEEEEEEEEcccc //