[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54095.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.78.1
:83 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   9->80 3d6nB PDBj 1e-08 20.8 %
:RPS:SCOP  29->80 1a1sA1  c.78.1.1 * 2e-07 31.4 %
:RPS:PFM   20->80 PF02729 * OTCace_N 3e-04 42.6 %
:HMM:PFM   28->81 PF02729 * OTCace_N 1.4e-09 37.0 54/142  
:BLT:SWISS 28->80 OTC_METTH 7e-06 43.4 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54095.1 GT:GENE BAF54095.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1229670..1229921 GB:FROM 1229670 GB:TO 1229921 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54095.1 LENGTH 83 SQ:AASEQ MVGTGRAGELFDPVDHFEAKRGPRVDGTAALFFPSSILRPRVSFERGAFAMGLQPITYPPETLEKSDDLSDVAGYLSAWVRLM GT:EXON 1|1-83:0| BL:SWS:NREP 1 BL:SWS:REP 28->80|OTC_METTH|7e-06|43.4|53/301| RP:PDB:NREP 1 RP:PDB:REP 9->80|3d6nB|1e-08|20.8|72/291| RP:PFM:NREP 1 RP:PFM:REP 20->80|PF02729|3e-04|42.6|61/142|OTCace_N| HM:PFM:NREP 1 HM:PFM:REP 28->81|PF02729|1.4e-09|37.0|54/142|OTCace_N| GO:PFM:NREP 2 GO:PFM GO:0006520|"GO:cellular amino acid metabolic process"|PF02729|IPR006132| GO:PFM GO:0016743|"GO:carboxyl- or carbamoyltransferase activity"|PF02729|IPR006132| RP:SCP:NREP 1 RP:SCP:REP 29->80|1a1sA1|2e-07|31.4|51/150|c.78.1.1| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 78 STR:RPRED 94.0 SQ:SECSTR #####HHHHHHHHHHHHHTTcccccccEEEEEEccccHHHHHHHHHHHHHTTcEEEEEETTTccTTccHHHHHHHHHHTTcEE DISOP:02AL 1-4| PSIPRED ccccccHHHHHHHHHHHHHcccccEEcEEEEEEcccccccEEEHHHHHHHHccccccccHHHHcccccHHHHHHHHHHHHHHc //