[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54101.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:73 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   25->50 PF01234 * NNMT_PNMT_TEMT 7.1e-06 30.8 26/256  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54101.1 GT:GENE BAF54101.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1236707..1236928 GB:FROM 1236707 GB:TO 1236928 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54101.1 LENGTH 73 SQ:AASEQ MIFSEEILHTDWFAALTAFVAINTTIYVVLAIAKTLPKIYVTDYLPRNYERAETRSIYPDVEEPKRKKPEKKD GT:EXON 1|1-73:0| TM:NTM 1 TM:REGION 8->30| SEG 62->72|eepkrkkpekk| HM:PFM:NREP 1 HM:PFM:REP 25->50|PF01234|7.1e-06|30.8|26/256|NNMT_PNMT_TEMT| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,59-74| PSIPRED cccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccccHHHHccccccHHHHHcccccccccHHHccHHccc //