[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54105.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  83/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:135 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->126 3bqxA PDBj 7e-19 38.0 %
:RPS:PDB   4->122 2a4wA PDBj 2e-13 20.2 %
:RPS:SCOP  1->128 1twuA  d.32.1.8 * 2e-13 16.0 %
:HMM:SCOP  1->126 1tsjA_ d.32.1.7 * 4.1e-21 24.6 %
:HMM:PFM   5->122 PF00903 * Glyoxalase 2.6e-10 25.7 113/128  
:BLT:SWISS 10->122 Y911_MYCBO 1e-04 33.7 %
:PROS 1->91|PS00430|TONB_DEPENDENT_REC_1

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54105.1 GT:GENE BAF54105.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1239274..1239681) GB:FROM 1239274 GB:TO 1239681 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54105.1 LENGTH 135 SQ:AASEQ MEQRISFITLAMEDVARSREFYVDGLGWKPMFENDEVIMVPAGEHLILSLWSIEGFTAEIGQPPARGIAPITLAHNCATEKEVDTVLVLAASIGADVSPAVHREWGGYSGYFSDPDGFRWEIAMNPGPTRDYVLP GT:EXON 1|1-135:0| BL:SWS:NREP 1 BL:SWS:REP 10->122|Y911_MYCBO|1e-04|33.7|104/170| PROS 1->91|PS00430|TONB_DEPENDENT_REC_1|PDOC00354| BL:PDB:NREP 1 BL:PDB:REP 3->126|3bqxA|7e-19|38.0|121/136| RP:PDB:NREP 1 RP:PDB:REP 4->122|2a4wA|2e-13|20.2|119/128| HM:PFM:NREP 1 HM:PFM:REP 5->122|PF00903|2.6e-10|25.7|113/128|Glyoxalase| RP:SCP:NREP 1 RP:SCP:REP 1->128|1twuA|2e-13|16.0|125/137|d.32.1.8| HM:SCP:REP 1->126|1tsjA_|4.1e-21|24.6|126/0|d.32.1.7|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 87 OP:NHOMOORG 85 OP:PATTERN -----------------------------1-------------------------------------- ----------1---1------1---2------1-------------------111--1----1-------------------------------------1-----------------------------------------------------------------------------------------1--1---------------------1-----11---------------------------------------------------------------------------------------------------1-----------------------------------1------------1-------1-------1-1-----1------------1------1--121------------1---1---11-11--1------------------------------------------------1---11-1-----1-----11--------1--1111-----1------1-1-11-----1------------1111---111---111--1-----1--------1-----------------------------1---11-------------------------------------------------------------------------------------------------------------------------------------1-----------------------------1111----1---------------------1----------------------------111111----------1-------------------------------------- -------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 131 STR:RPRED 97.0 SQ:SECSTR ccccccEEEEEEccHHHHHHHHHTTTccccGGGccEEEEEcGGGcEEEEEEHHHHHTTcTTccccccccccEEEEEcccHHHHHHHHHHHHHTTccEEEEEEcTTcEEEEEEEcTTccEEEEEEEcccccc#### DISOP:02AL 1-1| PSIPRED cccEEEEEEEEcccHHHHHHHHHHHcccEEEEEcccEEEEEEcccEEEEEEcHHHccccccccccccccEEEEEEEcccHHHHHHHHHHHHHcccEEEEcccccccEEEEEEEcccccEEEEEEccccccccccc //