[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54136.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  25/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:137 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   54->137 3bqxA PDBj 6e-04 21.4 %
:RPS:SCOP  5->134 1u69A  d.32.1.7 * 5e-13 17.0 %
:HMM:SCOP  1->137 1u7iA_ d.32.1.7 * 9.4e-21 33.3 %
:RPS:PFM   5->135 PF06983 * 3-dmu-9_3-mt 7e-04 26.2 %
:HMM:PFM   9->134 PF00903 * Glyoxalase 5.1e-07 23.3 73/128  
:BLT:SWISS 5->135 PHNB_ECOLI 2e-08 26.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54136.1 GT:GENE BAF54136.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1265513..1265926 GB:FROM 1265513 GB:TO 1265926 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54136.1 LENGTH 137 SQ:AASEQ MVGTISTYITFKENTAEALKHWQEVFGGELNLLSYGQATLEALPFDPPADALAHGVLTLDNGGLISGGDSIEGQLPIRDTAYSMLYNAESVEDGRARIDKIVAAGGEETMKFEQAPWGGSYGQVFDKFGVMWSISAD GT:EXON 1|1-137:0| BL:SWS:NREP 1 BL:SWS:REP 5->135|PHNB_ECOLI|2e-08|26.9|130/100| SEG 42->53|alpfdppadala| RP:PDB:NREP 1 RP:PDB:REP 54->137|3bqxA|6e-04|21.4|84/136| RP:PFM:NREP 1 RP:PFM:REP 5->135|PF06983|7e-04|26.2|122/126|3-dmu-9_3-mt| HM:PFM:NREP 1 HM:PFM:REP 9->134|PF00903|5.1e-07|23.3|73/128|Glyoxalase| RP:SCP:NREP 1 RP:SCP:REP 5->134|1u69A|5e-13|17.0|112/156|d.32.1.7| HM:SCP:REP 1->137|1u7iA_|9.4e-21|33.3|129/134|d.32.1.7|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 28 OP:NHOMOORG 25 OP:PATTERN -------------------------------------------------------------------- -----1-1222---------------------------1------1----1-111---------1-1--------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111----111111---------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 84 STR:RPRED 61.3 SQ:SECSTR #####################################################EEEcccEEEEEEHHHHHHHHcccccccccccEEEEcccGGGHHHHHHHHHTTcEEEEEEEccTTccEEEEEEcTTccEEEEEEc DISOP:02AL 1-2,41-43| PSIPRED ccccEEEEEEEcccHHHHHHHHHHHHccEEEEEEEEEcccccccccccccEEEEEEEEEccEEEEEEccccccccccccccEEEEEEcccHHHHHHHHHHHHHcccEEEEcHHHccccccEEEEEcccccEEEEEEc //