[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54154.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  14/915 : Eukaryota  10/199 : Viruses  0/175   --->[See Alignment]
b.47.1b.71.1
:278 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   50->231 1slxB PDBj 8e-11 30.2 %
:RPS:PDB   52->238 1braA PDBj 4e-08 25.0 %
:RPS:SCOP  55->198 1ogsA1  b.71.1.2 * 9e-10 12.9 %
:HMM:SCOP  29->235 1arbA_ b.47.1.1 * 1.6e-26 28.1 %
:RPS:PFM   55->230 PF00089 * Trypsin 2e-05 31.1 %
:HMM:PFM   47->231 PF00089 * Trypsin 5.2e-23 28.7 181/219  
:BLT:SWISS 59->236 CTRB2_LITVA 6e-12 35.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54154.1 GT:GENE BAF54154.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1282511..1283347) GB:FROM 1282511 GB:TO 1283347 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54154.1 LENGTH 278 SQ:AASEQ MSSASFTTKALSVLAALTAASAPLVAASPAHALANARNVTGSSTTSDSIVRLHIGNTACTGTMITPTWAITARHCIPEDGIAGAAIGSSTLSQFQQVSQAILHPTADLALVELPNQASSNTVDLYGAHVQPGENGQAAGWGGYSAFGQNVAQQADVQIQRRVVNVPSPDRTAVLLEGTVSNGRLVPGDSGGPLYINGQLAGVLSMSTDVENDALDGTVGWYIPVAEHAEWIAYYTGKHIAPIAGAPAELVDATANPTFIPAPQPFTGSSIGGWALGSS GT:EXON 1|1-278:0| BL:SWS:NREP 1 BL:SWS:REP 59->236|CTRB2_LITVA|6e-12|35.7|168/271| SEG 10->36|alsvlaaltaasaplvaaspahalana| BL:PDB:NREP 1 BL:PDB:REP 50->231|1slxB|8e-11|30.2|172/219| RP:PDB:NREP 1 RP:PDB:REP 52->238|1braA|4e-08|25.0|180/223| RP:PFM:NREP 1 RP:PFM:REP 55->230|PF00089|2e-05|31.1|167/217|Trypsin| HM:PFM:NREP 1 HM:PFM:REP 47->231|PF00089|5.2e-23|28.7|181/219|Trypsin| GO:PFM:NREP 2 GO:PFM GO:0004252|"GO:serine-type endopeptidase activity"|PF00089|IPR001254| GO:PFM GO:0006508|"GO:proteolysis"|PF00089|IPR001254| RP:SCP:NREP 1 RP:SCP:REP 55->198|1ogsA1|9e-10|12.9|132/143|b.71.1.2| HM:SCP:REP 29->235|1arbA_|1.6e-26|28.1|192/263|b.47.1.1|1/1|Trypsin-like serine proteases| OP:NHOMO 37 OP:NHOMOORG 24 OP:PATTERN -------------------------------------------------------------------- ------21212--1---------------------------------------11--5--11--1-2-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ---------------------------------------------------------------------------------------------------------------11---4-----1--1--------1----------------------2-----------1-----------------2--------1-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 205 STR:RPRED 73.7 SQ:SECSTR ######################################cccEEccTTEEEEEEcccEEEEEEEEETTEEEEcGGGcccccEEEEccccTTccEEEEEEEEEEcTTcccEEEEEcccccccccccccccccTTcEEEEEEccccccccccccccEEEEcEEEEEEcccHHHHHHHcTTTccTTEEEETcTTcEEEETTEEEEEEEEcccccccccTTccEEEEEGGGcHHHHHHHHHTcccccc################################### DISOP:02AL 1-2,241-241,244-244,246-246,251-251,253-266,277-279| PSIPRED ccccEEHHHHHHHHHHHHHHHHHcccccccccccccEEEccccccHHHEEEEEcccEEEEEEEEcccEEEEEEEEEccccEEEEEEEcccccEEEEEEEEEEcccccEEEEEEcccEEEEEEcccccccccccEEEEEEEEEcccccccccEEEEEEEEcccccccccccccEEEEccccccccccccccccEEEccEEEEEEEEcccccccccccccEEEEEHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccc //