[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54162.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:137 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   22->109 PF05297 * Herpes_LMP1 0.00035 26.2 84/381  
:BLT:SWISS 23->128 RBSU_STAES 1e-04 35.6 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54162.1 GT:GENE BAF54162.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1290961..1291374 GB:FROM 1290961 GB:TO 1291374 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54162.1 LENGTH 137 SQ:AASEQ MAESKRVRNKSFIHRNLGKGEVFGGLFWLSLGALISVLLEVIYLGTRITLPGGTSLAFPYTIAIAFLFNMVLTRTSMLWTDHWLAKFTPLTVWILGFMALLVWTVVAGDQLIPNNIRTVLLLFAGFSGGIWPAVKGK GT:EXON 1|1-137:0| BL:SWS:NREP 1 BL:SWS:REP 23->128|RBSU_STAES|1e-04|35.6|104/293| TM:NTM 3 TM:REGION 21->43| TM:REGION 56->76| TM:REGION 96->118| HM:PFM:NREP 1 HM:PFM:REP 22->109|PF05297|0.00035|26.2|84/381|Herpes_LMP1| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- -----111111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-10,137-138| PSIPRED ccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHccccEEcccHHHHHHHHHHHHHHccccccccc //