[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54163.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  387/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.1
:105 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->104 2v2kB PDBj 7e-41 69.6 %
:RPS:PDB   3->63 1bc6A PDBj 2e-07 59.0 %
:RPS:SCOP  16->59 1durA  d.58.1.1 * 6e-10 53.5 %
:HMM:SCOP  3->100 1q16B_ d.58.1.5 * 3.3e-18 27.8 %
:HMM:PFM   16->27 PF00037 * Fer4 5e-05 66.7 12/24  
:HMM:PFM   34->55 PF00037 * Fer4 1.3e-11 50.0 22/24  
:BLT:SWISS 2->104 FER_STRGR 2e-45 72.8 %
:PROS 40->51|PS00198|4FE4S_FER_1
:REPEAT 2|1->27|32->56
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54163.1 GT:GENE BAF54163.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1291442..1291759 GB:FROM 1291442 GB:TO 1291759 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54163.1 LENGTH 105 SQ:AASEQ MTYTIAQPCVDVLDRACVEECPVDCIYEGKRMLYIHPDECVDCGACEPACPVEAIFYEDDVPDEWLDYNDANAAFFDDLGSPGGAAKLGPQDFDHPMIAALPPQA GT:EXON 1|1-105:0| BL:SWS:NREP 1 BL:SWS:REP 2->104|FER_STRGR|2e-45|72.8|103/105| PROS 40->51|PS00198|4FE4S_FER_1|PDOC00176| NREPEAT 1 REPEAT 2|1->27|32->56| SEG 69->78|ndanaaffdd| BL:PDB:NREP 1 BL:PDB:REP 2->104|2v2kB|7e-41|69.6|102/102| RP:PDB:NREP 1 RP:PDB:REP 3->63|1bc6A|2e-07|59.0|61/77| HM:PFM:NREP 2 HM:PFM:REP 16->27|PF00037|5e-05|66.7|12/24|Fer4| HM:PFM:REP 34->55|PF00037|1.3e-11|50.0|22/24|Fer4| RP:SCP:NREP 1 RP:SCP:REP 16->59|1durA|6e-10|53.5|43/55|d.58.1.1| HM:SCP:REP 3->100|1q16B_|3.3e-18|27.8|97/509|d.58.1.5|1/1|4Fe-4S ferredoxins| OP:NHOMO 533 OP:NHOMOORG 387 OP:PATTERN -------------------------------------------------------------------- 112-111122111113433-3322533333343454456924331121122131211111114111222111111111----3-------------------------2---------------------------11111---11-------------------------------------12111---1-----------------2-----------12-------------------------------------------------------------------------------------------------------------------1----------------------111--111----1-2111111111111-1222111211111111111112111111211112222111211112311112111111111111111121111111111111111111111111111111111111111111111111121122211111122222111222211122211111112212331121-21-------11111-------------------------111111---------------------------33----111-11------------------12---1111--------------------------------------------------------------------------------------------111111111-11111-----------------111111111122221111111111111111111111-----111111111111111111111111----111111------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 103 STR:RPRED 98.1 SQ:SECSTR #cEEcccTTTTccccccTTTcTTccEEEccccEEEcTTTccccccHHHHcGGGccEETTTccHHHTHHHHHHHHTTTTTccccccTTTcccccccHHHHTcccc# DISOP:02AL 104-106| PSIPRED ccEEEcccccccccccHHHHcccccEEEcccEEEEcHHHcccccccHHHcccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccHHccccccc //