[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54167.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  132/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.81.1
:297 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   18->279 3fsyD PDBj 2e-84 67.9 %
:RPS:PDB   143->287 3eevB PDBj 1e-04 8.1 %
:RPS:SCOP  127->250 1kgqA  b.81.1.2 * 3e-11 25.2 %
:HMM:SCOP  35->279 1tdtA_ b.81.1.2 * 2.9e-37 22.6 %
:BLT:SWISS 125->265 DAPD_ACTSZ 2e-06 31.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54167.1 GT:GENE BAF54167.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1294858..1295751) GB:FROM 1294858 GB:TO 1295751 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54167.1 LENGTH 297 SQ:AASEQ MTTASATGIATLTSTGDVLDVWYPEIGSTDQSALTPLEGVDEDRNVTRKIVTTTIDIDAAPTDTYDAWLRLHLLSHRVFRPHTINLDGIFGLLNNVVWTNFGPCAVDGFALTRARLSRRGQVTVYSVDKFPRMVDYVVPSGVRIGDADRVRLGAYLADGTTVMHEGFVNFNAGTLGASMVEGRISAGVTVDDGTDVGGGASIMGTLSGGGQHVISLGKRCLLGANSGCGIPLGDDCIIEAGLYITAGTKVLFDGSLHKASTLAGSNGLIFRRDSVSGQVVAVPNTKVVELNTALHSN GT:EXON 1|1-297:0| BL:SWS:NREP 1 BL:SWS:REP 125->265|DAPD_ACTSZ|2e-06|31.1|132/275| SEG 50->67|ivtttididaaptdtyda| SEG 187->199|gvtvddgtdvggg| BL:PDB:NREP 1 BL:PDB:REP 18->279|3fsyD|2e-84|67.9|262/308| RP:PDB:NREP 1 RP:PDB:REP 143->287|3eevB|1e-04|8.1|135/205| RP:SCP:NREP 1 RP:SCP:REP 127->250|1kgqA|3e-11|25.2|123/274|b.81.1.2| HM:SCP:REP 35->279|1tdtA_|2.9e-37|22.6|234/0|b.81.1.2|1/1|Trimeric LpxA-like enzymes| OP:NHOMO 137 OP:NHOMOORG 132 OP:PATTERN -------------------------------------------------------------------- -----12222211-11111-11111111111111111111----111-1111111111--1111111111-1111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------1111111111111111111111111------11--1-1--------------------1-------------1----------------------------------------------------------------------------------------------1111-------------------------1111111111111111111----------11111111111111------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 272 STR:RPRED 91.6 SQ:SECSTR #################EEEEEccEccccEEEEcccHHEEETTTTEEEEEEEEEccTTcccccHHHHHHHHHHHHTTcccTTccccTTHHHHcccEEEETTEEEEcTTHHHHHHHHTTTccccEEEEEccccGGGTcccTTcGGGGEEcccccccccccEEEccTcccEEETTcEEEccTTTccTTccccccGGGcccGGGTTccccccccccEEEccccEEcTTcEETcEEcTTcEEcTTcEEcTTcEEEcTccccTTEEEETTTTEEEEEcccHHHHHHHHHHcGHc######## DISOP:02AL 1-1,296-298| PSIPRED cccEEEEEEEEEEccccEEEEEccccccccccHHHHcccccccccccEEEEEEEEEcccccccHHHHHHHHHHHHccccccccccccccccccccEEEcccccEEcccccccHHHHHHcccEEEEEEcccHHHHHHHHcccEEEccccEEEcccEEccccEEccccEEEEccEEccccEEccEEEEEEEEccccccccccEEEEEccccccccEEEccccEEEccEEEEEEEccccEEEccEEEccccEEEEcccEEEEEEcccccccEEEEccccEEEEEEEcccEEEEcHHHHcc //