[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54171.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  377/915 : Eukaryota  26/199 : Viruses  0/175   --->[See Alignment]
c.129.1
:256 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   44->240 1wekB PDBj 3e-45 47.2 %
:RPS:PDB   69->244 2a33B PDBj 8e-28 25.3 %
:RPS:SCOP  69->242 1wehA  c.129.1.1 * 2e-57 30.3 %
:HMM:SCOP  37->244 1wekA_ c.129.1.1 * 3.5e-64 38.6 %
:RPS:PFM   112->240 PF03641 * Lysine_decarbox 1e-21 43.7 %
:HMM:PFM   112->240 PF03641 * Lysine_decarbox 1.3e-36 38.3 128/133  
:BLT:SWISS 68->242 FAS6_RHOFA 1e-12 32.7 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54171.1 GT:GENE BAF54171.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1299390..1300160 GB:FROM 1299390 GB:TO 1300160 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54171.1 LENGTH 256 SQ:AASEQ MAPKQTPSPEKNRNLVGPVLQRRQTEGTFDQRLLEMRADHDWKHADPWRVLRIQSEFVAGFDALHEMPKAVTVFGSARIKEDHPYYKAGVELGEKLVAADYAVVTGGGPGLMEAPNKGASEASGLSVGLGIELPHEQHLNPYVDLGLNFRYFFARKTMFLKYSQAFVCLPGGFGTLDELFEVLCMVQTGKVTNFPIVLIGTEFWAGLVDWIRHRLVEEGMIDEKDVDRMLVTDDLDQAVKFIVDAHAGLDVARRHN GT:EXON 1|1-256:0| BL:SWS:NREP 1 BL:SWS:REP 68->242|FAS6_RHOFA|1e-12|32.7|171/198| BL:PDB:NREP 1 BL:PDB:REP 44->240|1wekB|3e-45|47.2|195/206| RP:PDB:NREP 1 RP:PDB:REP 69->244|2a33B|8e-28|25.3|166/170| RP:PFM:NREP 1 RP:PFM:REP 112->240|PF03641|1e-21|43.7|126/131|Lysine_decarbox| HM:PFM:NREP 1 HM:PFM:REP 112->240|PF03641|1.3e-36|38.3|128/133|Lysine_decarbox| RP:SCP:NREP 1 RP:SCP:REP 69->242|1wehA|2e-57|30.3|165/171|c.129.1.1| HM:SCP:REP 37->244|1wekA_|3.5e-64|38.6|207/0|c.129.1.1|1/1|MoCo carrier protein-like| OP:NHOMO 497 OP:NHOMOORG 405 OP:PATTERN ---------------------------------1-------------------1-------------- 121111211112121---------------------11111111-1111---111111--111-1111111-111111----121211-----------112121111-1-------1-1----23312122211311111111-1131111111111-1--11-1111111--111--11-1--111--1---11111111111111--1----111------------------------------1111-----11-----11-------11-111----------------------------------------------------------------------------------------------111111111111----2--1-----22222222222---------22--222221111111--111111121112111111111----111-------------------------------21111111112112111212222232222-212111121121111112111111---1111111111111121221-11111111111111111111121--1---11-1111111111---------1111111-------1--------------------1----2111--------------------------------------------------------------------------------------------------------1--111-------------------1111-11112111111111111111111111-------------------------------1122-------------------------------------------1------111 1-------311---2-----------------------------------------------1-----1--1-------------------------------1----3-------------------------------------------------1----1---------3-2--19111-1-125-21-1----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 221 STR:RPRED 86.3 SQ:SECSTR ##################################HHccHHHHHHccHHHHHHHHHHHHHHTTcccTTccEEEEEccccccccHHHHHHHHHHHHHHHHTTcEEEEcccccHHHHHHHHHHHTTccEEEEEEEEEccccccEEEHHHHHHEEccHHHHHHHHTccEEEEccccHHHHHHHHHHHHHHHTTcccccEEEEcGGGTTHHHHHHHHHHHHHTTcccHHHHTTEEEEccHHHHHHHHHcTTHHHHHHHHH# DISOP:02AL 1-11,250-257| PSIPRED ccccccccHHHHHHHHcccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccccccccHHHHHHHHHHHHHHHcccEEEEcccccHHHHHHHHHHHcccEEEEEcccccccccccccEEEEEEEccHHHHHHHHHHHccEEEEEccccHHHHHHHHHHHHHHHcccccccEEEEcccccHHHHHHHHHHHHHcccccHHHccEEEEEccHHHHHHHHHHHHcccHHHHHHc //