[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54183.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.180.1
:164 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  59->124 1or7C  a.180.1.1 * 3e-06 13.3 %
:HMM:PFM   86->112 PF02448 * L71 0.00041 25.9 27/96  
:BLT:SWISS 39->103 OAF_CHICK 3e-04 37.3 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54183.1 GT:GENE BAF54183.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1309063..1309557 GB:FROM 1309063 GB:TO 1309557 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54183.1 LENGTH 164 SQ:AASEQ MFNSDTTANLQAKSRDRAGSKAKRSRPSFDSVARDVLDVRTKTAQVKNKAKEFSSVDHLSADAAAMFVDNELSRGAMHRARLHIVHCAECREEINRQRETVDYLRSECKNEEVSAPMDLKARLASLATECMPGPGAENLAMQRPESFVAKVESVVRAVRKNQGR GT:EXON 1|1-164:0| BL:SWS:NREP 1 BL:SWS:REP 39->103|OAF_CHICK|3e-04|37.3|59/100| HM:PFM:NREP 1 HM:PFM:REP 86->112|PF02448|0.00041|25.9|27/96|L71| RP:SCP:NREP 1 RP:SCP:REP 59->124|1or7C|3e-06|13.3|60/66|a.180.1.1| OP:NHOMO 10 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- -----111111111-------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,7-29,42-54,135-145,162-165| PSIPRED cccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccccccHHHccHHHHHHHHcccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHccc //