[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54189.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:222 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   44->175 2asnX PDBj 2e-04 13.1 %
:RPS:PFM   60->143 PF07021 * MetW 3e-05 34.2 %
:HMM:PFM   64->143 PF07021 * MetW 7.4e-05 29.5 78/193  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54189.1 GT:GENE BAF54189.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1313705..1314373 GB:FROM 1313705 GB:TO 1314373 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54189.1 LENGTH 222 SQ:AASEQ MKNVGKRILVLALGASVAGCSTLSQEPSPPVPLGYVDTVQIVSPNGDIESFVLGKLYETALVERGRSASVQLIDGDLDEQLSMLRDDSTDLVIACSGQLLEYYNPDLASELAVEYANQTAFDKNSGEWREKVYDALQGSLPYSIVATDPSNAIGCKDDTSLPQNIVPIYRKPNLDRGNRDTLNFVSGSLGTSDLEGLVKDAQTTGTTSETALDFLLSKGFSR GT:EXON 1|1-222:0| RP:PDB:NREP 1 RP:PDB:REP 44->175|2asnX|2e-04|13.1|122/179| RP:PFM:NREP 1 RP:PFM:REP 60->143|PF07021|3e-05|34.2|79/189|MetW| HM:PFM:NREP 1 HM:PFM:REP 64->143|PF07021|7.4e-05|29.5|78/193|MetW| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- -----111111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 122 STR:RPRED 55.0 SQ:SECSTR ###########################################TTccHHHHccccEEEEEEEcEEEEEEEEEETTEEEEEEEEEETTTTEEEEEEEEEEEcTTccEEEEEEEEEcTTccEEEccccc##########EEEEEEEEEEcccEEEEEEETTEEEEEEEEEEccTTcc############################################### DISOP:02AL 1-4,222-223| PSIPRED ccHHHHHHHHHHHccccHHHHHHccccccccccccEEEEEEEcccHHHHHHHHHHHHHHHHHHcccEEEEEEEEccccccccccccccccEEEEEccHHHHHccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHcccccEEEccccccccccccccccccccEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccc //