[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54193.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  29/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:239 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54193.1 GT:GENE BAF54193.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1322618..1323337) GB:FROM 1322618 GB:TO 1323337 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54193.1 LENGTH 239 SQ:AASEQ MAEHNAIITDAVHSDPAVLEDNAGFSGKYLIRALDKAAHMQTGAIEGYISWLRKHNPEKTPAQLQVLVDKHFMRLATGSGAGVGMAAAVPGIGFVTGALAVGAESLVFLDAAAFYTMASAHLRGIDIRHPERRRGLILVVLLGTAGKAIVDAGVGDLSKKNHAPGIAISRFNIGGLMEVNGRLMRYAVKEVSKRFRSAWIGKILPFGIGAVLGTMANRKIAKRTVGNAYDSLGPLPTHF GT:EXON 1|1-239:0| TM:NTM 3 TM:REGION 87->109| TM:REGION 136->158| TM:REGION 196->217| SEG 76->93|atgsgagvgmaaavpgig| SEG 132->143|rrrglilvvllg| OP:NHOMO 29 OP:NHOMOORG 29 OP:PATTERN -------------------------------------------------------------------- -----11111111-1--11-11---111111-111111-----------11----1-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,237-240| PSIPRED ccccccccHHHccccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHccccHHcccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc //