[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54194.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  36/68 : Bacteria  476/915 : Eukaryota  69/199 : Viruses  0/175   --->[See Alignment]
c.2.1c.58.1
:268 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->268 1npyB PDBj 3e-62 46.2 %
:RPS:PDB   25->263 2d5cA PDBj 9e-43 28.5 %
:RPS:SCOP  13->105 1npdA2  c.58.1.5 * 8e-23 37.6 %
:RPS:SCOP  106->268 1npyA1  c.2.1.7 * 1e-45 46.6 %
:HMM:SCOP  4->105 1npyA2 c.58.1.5 * 4e-27 40.2 %
:HMM:SCOP  106->263 1npyA1 c.2.1.7 * 1.8e-30 35.4 %
:RPS:PFM   27->93 PF08501 * Shikimate_dh_N 3e-09 40.3 %
:RPS:PFM   124->225 PF01488 * Shikimate_DH 4e-08 40.4 %
:HMM:PFM   26->93 PF08501 * Shikimate_dh_N 1.1e-18 42.6 68/83  
:HMM:PFM   122->177 PF01488 * Shikimate_DH 2.7e-05 26.8 56/135  
:BLT:SWISS 5->268 Y607_HAEIN 1e-61 46.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54194.1 GT:GENE BAF54194.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1323374..1324180) GB:FROM 1323374 GB:TO 1324180 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54194.1 LENGTH 268 SQ:AASEQ MVNYVDRETTLCISLAARPSNHGVRFHNWLYAELGLNYLYKAVAPADITAAVAGIRGLNIRGAGVSMPYKSDVIPLIDELDPSAERIRSVNTIVNNDGHLVGYNTDYTAVYHLLEEHRVDPNARVAIKGSGGMANAVVAALADYGLSGTVVARNHTTGSALASRYGWEYSATVPEDAKILVNVTPMGMNGPDQDVVSFGEDEVDRADVIFDCVAFPVETPLIKLAKEKGKQTIDGGEVAALQAAEQFHLYTGVLPTNEQIIAAEEFSK GT:EXON 1|1-268:0| BL:SWS:NREP 1 BL:SWS:REP 5->268|Y607_HAEIN|1e-61|46.2|264/271| SEG 42->53|avapaditaava| BL:PDB:NREP 1 BL:PDB:REP 5->268|1npyB|3e-62|46.2|264/270| RP:PDB:NREP 1 RP:PDB:REP 25->263|2d5cA|9e-43|28.5|235/261| RP:PFM:NREP 2 RP:PFM:REP 27->93|PF08501|3e-09|40.3|67/83|Shikimate_dh_N| RP:PFM:REP 124->225|PF01488|4e-08|40.4|94/115|Shikimate_DH| HM:PFM:NREP 2 HM:PFM:REP 26->93|PF08501|1.1e-18|42.6|68/83|Shikimate_dh_N| HM:PFM:REP 122->177|PF01488|2.7e-05|26.8|56/135|Shikimate_DH| GO:PFM:NREP 3 GO:PFM GO:0004764|"GO:shikimate 5-dehydrogenase activity"|PF01488|IPR006151| GO:PFM GO:0005737|"GO:cytoplasm"|PF01488|IPR006151| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01488|IPR006151| RP:SCP:NREP 2 RP:SCP:REP 13->105|1npdA2|8e-23|37.6|93/106|c.58.1.5| RP:SCP:REP 106->268|1npyA1|1e-45|46.6|163/167|c.2.1.7| HM:SCP:REP 4->105|1npyA2|4e-27|40.2|102/102|c.58.1.5|1/1|Aminoacid dehydrogenase-like, N-terminal domain| HM:SCP:REP 106->263|1npyA1|1.8e-30|35.4|158/0|c.2.1.7|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 687 OP:NHOMOORG 581 OP:PATTERN ---1---1------11-1-----11--1---111111111111-111111-1-111-111-111---- 112---11111----------1---1------1111-111---21------1111--1-----1--------------11-111111112111111---111111111111------1111111-11-111-1111----1111-11-----11111-11111-111---11111111111111-111-1-1-3111111111111111----21111111111133333311111111111111111-11111--1221--1-44--2--1-11-111111111111111111111111222222222222211111111111111111111111121233111111---1111-1111-111111111--1-11-----11111-222-1111-1111111111111---1-----11--12211112111111--1-1------11---------2221--------------------------------1111-1------------------------------------------------------1-1-------------1-11111---1111-----11-11------11--1111-----11111111111111111--1-------1-------1--------------------------2-1111111111111-1111211121111111112443--1--212-3323233121-3--111111--1111111-1111-----------------1----12-22221-12----------2-----2111-2323-1111111111111------------------------------11111111--------1-1---------------------------1-------1-- ------1-----1111121-321121111111111111-11111----111221111-11111--1----------------11--11-11-1--1111-1-111----------------------------------------------------------------------1------1--1--1111-----1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 264 STR:RPRED 98.5 SQ:SECSTR ####ccTTcEEEEEEEEcccTTcHHHHHHHHHHTTccEEEEEEEccGGGHHHHHHHHHHccEEEEcTTcTTGGGGGccEEcHHHHHHTcccEEEEETTEEEEEccHHHHHHHHHHHTTccccccEEEEcccHHHHHHHHHHHHTTccEEEEcccHHHHHHHHHHHTEEccGGGGGGccEEEEcccTTTTcTTTTccccccGGGccccEEEEccccccccHHHHHHHHTTcEEEccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHH DISOP:02AL 1-5| PSIPRED ccccccccccEEEEEEcccHHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHccccEEEEEcccHHHHHHHcccccHHHHHcccccEEEEEccEEEEEccHHHHHHHHHHHcccccccEEEEEcccHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHccccHHHHccccccEEEEcccccccccccccccccHHHcccccEEEEEcccccccHHHHHHHHcccEEEccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHcc //