[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54196.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:217 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   195->216 PF11575 * FhuF_C 8.5e-09 31.8 22/22  
:BLT:SWISS 143->207 MNME_DEIRA 4e-04 27.7 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54196.1 GT:GENE BAF54196.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1326112..1326765 GB:FROM 1326112 GB:TO 1326765 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54196.1 LENGTH 217 SQ:AASEQ MSIWKRLLVQYPRFADTLTAGQPITLEELATREVILEAVAKGQEIFGIEQPKHAAQLWFHSLCTAIVGPAVTAMVEFDVIPSLDIHRGQLHNIDGYWFGFRPEEMLVDASLHLSGTQFGESIRVVIDALCAATDLRPAPLWAVASDALGIAASGAGVEAFEEEHAREVAEALIEGMNSVNSVPSPRFNDDDYFIRAGCCMIFHSPRAAFCTSCPQKR GT:EXON 1|1-217:0| BL:SWS:NREP 1 BL:SWS:REP 143->207|MNME_DEIRA|4e-04|27.7|65/100| HM:PFM:NREP 1 HM:PFM:REP 195->216|PF11575|8.5e-09|31.8|22/22|FhuF_C| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- ------11111-1------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,216-218| PSIPRED ccHHHHHHHHcHHHHHHcccccEEcHHHHHccHHHHHHHHccccEEcccccccHHHHHHHHHHHHHHccEEEEEEEEEcccccEEcccEEEcccccEEEcccccEEEcHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEEEEEEcccccccccccccc //