[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54197.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:277 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54197.1 GT:GENE BAF54197.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1326860..1327693 GB:FROM 1326860 GB:TO 1327693 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54197.1 LENGTH 277 SQ:AASEQ MSFFEDIAAGLDSDGIESRVNGDTMFVPITSDLEIQFVEIDSLLPAANVYIAAANVDEDDDEFEAVLVSVVFSVEDAVAAVAKHVATDQVVTVLRDLLEGTDERIQDLEFFQDAVNANLVRAEVGQNSELQVLVEVEDGVPTATVNFIAIGESFEDLIDQAIEELWESDGDAVLSDEDRQRMFADLTSELEFVTDEVLDLGTFTDFDRLFDILSLADDQAEDWEAQLVPFEDEEFDEPDVYDLFVDDSEEDDDEDDGDDDFDDDLDDDEDDEDDDED GT:EXON 1|1-277:0| SEG 229->239|pfedeefdepd| SEG 246->276|ddseedddeddgdddfdddldddeddeddde| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- -----111111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,269-278| PSIPRED ccHHHHHHHHHHHcccHHHccccEEEEEEccccEEEEEEEccccccccEEEEEccccccHHHHHHHHHHHEEEEEcHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHccccEEEEEEccccEEEEEEEcccccccccccEEEEcccHHHHHHccHHHcccccccEEEcccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc //