[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54199.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  153/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:405 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   65->190 2d33D PDBj 5e-08 6.3 %
:RPS:PDB   168->232 3bupA PDBj 9e-04 27.6 %
:RPS:SCOP  65->384 1pv6A  f.38.1.2 * 1e-16 16.4 %
:HMM:SCOP  9->405 1pv7A_ f.38.1.2 * 2.8e-74 26.3 %
:RPS:PFM   20->186 PF07690 * MFS_1 5e-11 30.7 %
:RPS:PFM   274->386 PF07690 * MFS_1 9e-11 29.2 %
:HMM:PFM   22->243 PF07690 * MFS_1 1.6e-31 27.9 219/353  
:HMM:PFM   223->396 PF07690 * MFS_1 2.2e-29 30.1 173/353  
:BLT:SWISS 2->235 YFMO_BACSU 1e-11 22.1 %
:BLT:SWISS 273->405 MDTH_ENTS8 2e-09 27.1 %
:PROS 274->290|PS00216|SUGAR_TRANSPORT_1
:TM
:REPEAT 2|66->187|269->390
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54199.1 GT:GENE BAF54199.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1328360..1329577 GB:FROM 1328360 GB:TO 1329577 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54199.1 LENGTH 405 SQ:AASEQ MLTQKIELEAKPKIPEQIWVLVVAAFIIALGYGLIAPILPQFVVGFDVSFAAASAVVSIFAGARLLFAPMSGSLIDKIGSRRVYLTGLLTVAITTGLVALAQEYWQILLLRGIAGIGSTMFTVSAMGLIVKMAPVEIRGRCSSVYASSFLFGNIIGPVVGAAMSGLGMRWPFAIYGASVGLAALVVWWRMPKTNDSLRKADSNSVPALRFAEAIKDSAYRSALFSAFANGWSNFGVRVAVLPLFAAAAFSNGGAIAGFAMAAFAAGNALCLQFAGDLSDRIGRKPMIISGLIVNAVFTAMIGFGTEVWILITVSALAGAGAGLLNPSQQAVLADVIDSRPGGKVLANFQMAQDFGAIVGPILVGMIAEQAGFQIGFMLCGVISLLAAVAWIFGRETLPTAKVEQV GT:EXON 1|1-405:0| BL:SWS:NREP 2 BL:SWS:REP 2->235|YFMO_BACSU|1e-11|22.1|222/396| BL:SWS:REP 273->405|MDTH_ENTS8|2e-09|27.1|129/402| PROS 274->290|PS00216|SUGAR_TRANSPORT_1|PDOC00190| TM:NTM 10 TM:REGION 15->37| TM:REGION 48->70| TM:REGION 83->103| TM:REGION 110->132| TM:REGION 144->166| TM:REGION 171->193| TM:REGION 246->268| TM:REGION 293->315| TM:REGION 348->370| TM:REGION 373->395| NREPEAT 1 REPEAT 2|66->187|269->390| SEG 42->63|fvvgfdvsfaaasavvsifaga| SEG 238->268|vavlplfaaaafsnggaiagfamaafaagna| SEG 315->324|alagagagll| RP:PDB:NREP 2 RP:PDB:REP 65->190|2d33D|5e-08|6.3|126/499| RP:PDB:REP 168->232|3bupA|9e-04|27.6|58/1015| RP:PFM:NREP 2 RP:PFM:REP 20->186|PF07690|5e-11|30.7|166/347|MFS_1| RP:PFM:REP 274->386|PF07690|9e-11|29.2|113/347|MFS_1| HM:PFM:NREP 2 HM:PFM:REP 22->243|PF07690|1.6e-31|27.9|219/353|MFS_1| HM:PFM:REP 223->396|PF07690|2.2e-29|30.1|173/353|MFS_1| GO:PFM:NREP 2 GO:PFM GO:0055085|"GO:transmembrane transport"|PF07690|IPR011701| GO:PFM GO:0055085|"GO:transmembrane transport"|PF07690|IPR011701| RP:SCP:NREP 1 RP:SCP:REP 65->384|1pv6A|1e-16|16.4|318/417|f.38.1.2| HM:SCP:REP 9->405|1pv7A_|2.8e-74|26.3|395/417|f.38.1.2|1/1|MFS general substrate transporter| OP:NHOMO 198 OP:NHOMOORG 158 OP:PATTERN ----------------------------------1--1----------1------------------- -----1-2221--1111----2---2------222211221-----11-22-122211----11112-1------------------------------------1--1------------------------------------2---------------------------------------1-----2-111111132--2-2221-22112-2--21----11-1131--------------------1-1-----1-1--11--------111-------------------------------------------------------------11--------------11-1----1---------------------1-------1-------------1-------------1---22111211--11-1---------11111111----1--1--------------------------------1------------------------------1----------------------------------------------1-1----111-------1--------------------------------------------------------------------------------2----1----------------------------------11---1111-1111111111-1-------1-----------------------------------------------------------1---1---1111-111--------------------------11111-11--------------------------------------------------------------- --------------------------1-------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 166 STR:RPRED 41.0 SQ:SECSTR ################################################################TcccGGGcTTcccccTTccccccHHHHHHHHHHHHHcccHHHHTTccEETTEEccccccccccGGGccccEEEEccccTTccHHHHHHHHcccEEEEEEccTTcTTcccHHHHHHHHHHHHHHHHcEEccTTccGGG#GcEEEccEE#EEEcccEEEEEEEcccEEEE############################################################################################################################################################################# DISOP:02AL 1-2,5-12,400-406| PSIPRED cccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHccc //