[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54200.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  46/68 : Bacteria  720/915 : Eukaryota  106/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:449 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   27->188 2gfpA PDBj 1e-11 25.9 %
:RPS:PDB   69->181 2d33D PDBj 2e-04 9.7 %
:RPS:SCOP  8->187 1pw4A  f.38.1.1 * 9e-15 17.9 %
:HMM:SCOP  1->190 1pw4A_ f.38.1.1 * 1.3e-48 36.0 %
:HMM:SCOP  198->440 1pw4A_ f.38.1.1 * 7.4e-30 25.7 %
:RPS:PFM   16->326 PF07690 * MFS_1 5e-28 34.6 %
:HMM:PFM   17->407 PF07690 * MFS_1 1.8e-59 32.1 343/353  
:BLT:SWISS 12->399 YEBQ_ECOLI 3e-39 29.3 %
:PROS 400->444|PS00041|HTH_ARAC_FAMILY_1
:PROS 324->338|PS00211|ABC_TRANSPORTER_1
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54200.1 GT:GENE BAF54200.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1329578..1330927 GB:FROM 1329578 GB:TO 1330927 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54200.1 LENGTH 449 SQ:AASEQ MTPIVESRAWKALGALSVGLFLTLLDQSLVAVALPKIQEDLGASLNQAVWVSAVYLLTFAVPLLITGRLGDRYGQRNIYLAGMAVFTLAALACVFAPSIEWLIAARAMQGLGGSLLNPQPLSIIHKIFAHDRRGAATGVWSAVASSAGLFGPVIGGVLVGWISWRAVFLVYVPLGLISLFMVARYVPKLPTGTSKIDWLSGAVSLVAVLGVVLALQQGPELGWGTLIWVSLAVGIAAAVIFIWMQTRSKAPLMPLRIFKTRNFAIGAFSIFSLGFTVYSVNLPIMLYLQTAQGMSSQLAGLMLVPMGIISVVMSPVIGRLVDRLAPGMISKIGFGALIFSMALMAVFMIANLSPWWLLIPIILFGSSNAMSFAPNSAIALRDVPQDLVGSASGFYNTSRQVGAVLGAATLGAVMQIGVGTVSFGVAMGAAILVTLVPLIFGFLAVTQFR GT:EXON 1|1-449:0| BL:SWS:NREP 1 BL:SWS:REP 12->399|YEBQ_ECOLI|3e-39|29.3|379/457| PROS 400->444|PS00041|HTH_ARAC_FAMILY_1|PDOC00040| PROS 324->338|PS00211|ABC_TRANSPORTER_1|PDOC00185| TM:NTM 12 TM:REGION 13->35| TM:REGION 48->70| TM:REGION 80->102| TM:REGION 137->159| TM:REGION 166->188| TM:REGION 196->218| TM:REGION 222->243| TM:REGION 261->283| TM:REGION 297->319| TM:REGION 336->358| TM:REGION 398->420| TM:REGION 425->447| SEG 199->215|lsgavslvavlgvvlal| SEG 354->363|pwwllipiil| SEG 401->413|vgavlgaatlgav| BL:PDB:NREP 1 BL:PDB:REP 27->188|2gfpA|1e-11|25.9|162/375| RP:PDB:NREP 1 RP:PDB:REP 69->181|2d33D|2e-04|9.7|113/499| RP:PFM:NREP 1 RP:PFM:REP 16->326|PF07690|5e-28|34.6|269/347|MFS_1| HM:PFM:NREP 1 HM:PFM:REP 17->407|PF07690|1.8e-59|32.1|343/353|MFS_1| GO:PFM:NREP 1 GO:PFM GO:0055085|"GO:transmembrane transport"|PF07690|IPR011701| RP:SCP:NREP 1 RP:SCP:REP 8->187|1pw4A|9e-15|17.9|179/434|f.38.1.1| HM:SCP:REP 1->190|1pw4A_|1.3e-48|36.0|189/447|f.38.1.1|1/2|MFS general substrate transporter| HM:SCP:REP 198->440|1pw4A_|7.4e-30|25.7|237/447|f.38.1.1|2/2|MFS general substrate transporter| OP:NHOMO 6654 OP:NHOMOORG 872 OP:PATTERN ------9655555586-5131--21111--112121-11111-AB6453-351----11-17762--- 44A6z55ACCE668A8A99-9A22LI99999CECCDPfeT6QDNDD865962FFE628--NOB3G9JaaZ34444433-2614131113311-2-----214121E-423--------------111111-1111-7775621153--2------11-1--2-1--2--31------------4341--12A2ECCDCDBBF6EFDCDD94CA7CCDC4446563778887HR365656555555555955976773FH35525GF66GF73977998633321-1146-----------11111111111111-1---21111--AC111212121145CC1443-----4--2-784341-23321111--11-E3352113445HBC525985553355355455C-66755C5A5I3-L666FH6GJHAB66-3-13322223219899999958764219--1--111----1111121111111--1--15B447A79CWZabZYOIIJHPPcUKKJK9LhQdAIHF--DDG22B45C494E4492-322752222222-1-2241352413123122424-223142145348212---1------1-1--------111-88648232-123213333233433113311311-1---1------BDBA4G5BBBABBBBBA-BBACCABC9CBCBAABAA8HRKBDAC8B96B9A99AAA9B9B8IA97BBB731C66666666666--116545444331-453111132-32-11223BBBBB661133299898FCG6A9C4468744444544423465333336643376565664331---------1111-----------------------------------------11111131 ----11-----1-13FMSHTUYSkltWHHDGFETNIDGDE8FHDC9WKLYaP*bFNSJJABD456158452491F66545367755A8-IKAM4CBGEDH7-5877--3----1--------------------------------------------21-----1-5-----11----7---1-----P----2---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 162 STR:RPRED 36.1 SQ:SECSTR ##########################HHHHHHHHHHHHTTcccTTHHHHHHHHHHHHHHHHHHTTHHHTcccccTTccccccHHHHHHHHHHHHHcccHHHHTTccEETTEEccccccccccGGGccccEEEEccccTTccHHHHHHHHcccEEEEEEEccTTcTTcccHHHHHHHHHHHHccccccc##################################################################################################################################################################################################################################################################### DISOP:02AL 1-5| PSIPRED ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //