[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54202.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:115 amino acids
:PSIPRED
:HMM:PFM   1->37 PF04070 * DUF378 0.00074 32.4 37/62  
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54202.1 GT:GENE BAF54202.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1333733..1334080 GB:FROM 1333733 GB:TO 1334080 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54202.1 LENGTH 115 SQ:AASEQ MIIIASVVFLLVGAMLANVAAALFSASEPFGRISYLIGLPNEDDFVPYSLRFVAFFPLMLSASMAASFFGVWAVLIIPFGYFPSLMMVHKHNKQVQRTWDSVTVADFYEDSTPLV GT:EXON 1|1-115:0| TM:NTM 2 TM:REGION 7->29| TM:REGION 56->78| HM:PFM:NREP 1 HM:PFM:REP 1->37|PF04070|0.00074|32.4|37/62|DUF378| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHccccccc //