[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54216.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  433/915 : Eukaryota  157/199 : Viruses  0/175   --->[See Alignment]
:468 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   198->323 3giaA PDBj 5e-08 27.2 %
:RPS:PFM   22->407 PF00324 * AA_permease 4e-39 33.4 %
:HMM:PFM   18->429 PF00324 * AA_permease 1.7e-98 35.0 408/479  
:BLT:SWISS 12->444 PROY_SALTY e-106 51.0 %
:PROS 43->73|PS00218|AMINO_ACID_PERMEASE_1
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54216.1 GT:GENE BAF54216.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1350817..1352223) GB:FROM 1350817 GB:TO 1352223 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54216.1 LENGTH 468 SQ:AASEQ MNASPAPTRSFRGLRARHIHFIALGSAIGTGLFYGSAGAIQAAGPSVLLVYLLGGAVVYFMLRALGEMAVHHPVRGSFAVYTRAHLGGWAGYITGWMFAFEMLIVCLADLTAIGIYMNFWFPGTPQWTWVVATLLIVGGANLASVRWFGELEFIFTIIKVTAVVAMIVGGAAILAFGLGANAEVAGVSNLWEQGGFFPNGVEGMIAAFILVLFAFGGTEIIGVAGSEAEDPEKSIPKAVNTVPVRILLFYVGAILVILALNPWPSITGEESPFVQIFDTLGVNWAAGLLNAVVITAALSAINADLFGAGRVLTGLAKENLAPKAMGKIAKNGVPVMTTTIMIIVLIVGVILNAVLPERVFEIVASLATFATVYVWLMILLAQVGSRRNMPADEVKSLKFPVPFYPFGQYFAILFIAFTFGIMVWYDNYHLPLAVGVGFLALMTILYYATGRPKAIAPINYEELDPRRD GT:EXON 1|1-468:0| BL:SWS:NREP 1 BL:SWS:REP 12->444|PROY_SALTY|e-106|51.0|433/456| PROS 43->73|PS00218|AMINO_ACID_PERMEASE_1|PDOC00191| TM:NTM 12 TM:REGION 18->40| TM:REGION 44->66| TM:REGION 97->118| TM:REGION 127->149| TM:REGION 154->176| TM:REGION 204->226| TM:REGION 239->261| TM:REGION 284->306| TM:REGION 332->354| TM:REGION 361->383| TM:REGION 402->423| TM:REGION 431->451| SEG 47->59|vllvyllggavvy| SEG 160->182|vtavvamivggaailafglgana| SEG 332->351|gvpvmtttimiivlivgvil| BL:PDB:NREP 1 BL:PDB:REP 198->323|3giaA|5e-08|27.2|125/433| RP:PFM:NREP 1 RP:PFM:REP 22->407|PF00324|4e-39|33.4|380/429|AA_permease| HM:PFM:NREP 1 HM:PFM:REP 18->429|PF00324|1.7e-98|35.0|408/479|AA_permease| GO:PFM:NREP 3 GO:PFM GO:0006810|"GO:transport"|PF00324|IPR004841| GO:PFM GO:0016020|"GO:membrane"|PF00324|IPR004841| GO:PFM GO:0055085|"GO:transmembrane transport"|PF00324|IPR004841| OP:NHOMO 3512 OP:NHOMOORG 596 OP:PATTERN ------1----------------1-------------------2---1---------1-1-------- 1---142333424261144-412263444444-22218ED----3-211222A8B824-----A119554-4333555----1------------------11----1-2-----------------1---------------------------------------------------------------5-B7787878868A788911668C88743691914444446155555555555555466667144243273457766432536416662221111-33-----------1111111111111-212221111---45111111111---551111--------1-2212--1-12----------2---34334-1-----------1-111111112------2------111-111--1--1--------------44444444-222------------------------------------1--211-19DDCD937676BB44998959E927655-1332--1--71---1-------42---------------------3--------------------------1-------2-1112111-------111---------------------------1------------8767685A998A88899-99B9988989989999998EEE797749899999999999899B98888894-888788788888--3------1111--------------------FFGGDA8-----8888AA49-GKGC1333333333333---------------2233333333--------------------------------------------------------------- ------------322FGABIECBJKIK887666CCBCBAAA9B999GDGGLQbWCDG88989FJMCEE3GDDMBKFF8FEBIJLMKE8-5G4G49B6463957879-----543225111-233722315F31414211-3-12222-1133132352416F1--1-311I-------------11123B2---2111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 125 STR:RPRED 26.7 SQ:SECSTR #####################################################################################################################################################################################################HHHHHHHHHHHHHGGGGGTHHHHHHTTGGGcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHTGGGHHHHHHHHHHH#HHHHHHHHHHHHHHHHHHHHHHHTTTHHHHHHHHHHccccc################################################################################################################################################# DISOP:02AL 1-15,462-469| PSIPRED ccccccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHcccccc //