[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54230.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  55/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:162 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->128 3f3xA PDBj 6e-06 27.6 %
:RPS:PDB   11->146 2a61A PDBj 8e-12 15.2 %
:RPS:SCOP  12->148 3broA1  a.4.5.28 * 6e-16 16.3 %
:HMM:SCOP  7->148 1jgsA_ a.4.5.28 * 7.1e-25 26.8 %
:HMM:PFM   39->99 PF01047 * MarR 1.6e-08 30.5 59/59  
:BLT:SWISS 14->145 Y2019_BACC1 2e-06 23.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54230.1 GT:GENE BAF54230.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1372617..1373105 GB:FROM 1372617 GB:TO 1373105 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54230.1 LENGTH 162 SQ:AASEQ MTTPRWLSTEEQQLWRMILSATRKMERTLDETLVENHNLTTSEFAVLVTLSEATGQQMRLRDMCQELDWDRSRTSHQVTRMDKKGLVAKVKCAGDARGVNVEITPEGERRLKDAVPAHVETVRQLVFDPMEEHHMEGLRSYLTAVLNSSTCIEINNQRAAEL GT:EXON 1|1-162:0| BL:SWS:NREP 1 BL:SWS:REP 14->145|Y2019_BACC1|2e-06|23.0|126/147| BL:PDB:NREP 1 BL:PDB:REP 10->128|3f3xA|6e-06|27.6|116/139| RP:PDB:NREP 1 RP:PDB:REP 11->146|2a61A|8e-12|15.2|132/142| HM:PFM:NREP 1 HM:PFM:REP 39->99|PF01047|1.6e-08|30.5|59/59|MarR| RP:SCP:NREP 1 RP:SCP:REP 12->148|3broA1|6e-16|16.3|135/135|a.4.5.28| HM:SCP:REP 7->148|1jgsA_|7.1e-25|26.8|138/0|a.4.5.28|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 136 OP:NHOMOORG 55 OP:PATTERN -------------------------------------------------------------------- ----61122221111------1---5------233355451315521121122232-1--1142A234471-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------1-----------------------------------------------------------------------------------11----------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 153 STR:RPRED 94.4 SQ:SECSTR #TTcccHHHHcHHHHHHHHHHHHHHHHHHHTTHGHHHTccHHHHHHHHHHHHHccccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEETTEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHTccc######## DISOP:02AL 1-1,151-163| PSIPRED ccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccccccc //