[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54234.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  18/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.17
:78 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->71 2qifB PDBj 1e-10 36.9 %
:RPS:PDB   7->75 3cjkB PDBj 8e-16 24.6 %
:RPS:SCOP  8->75 1aw0A  d.58.17.1 * 2e-15 27.9 %
:HMM:SCOP  7->79 1k0vA_ d.58.17.1 * 7.8e-16 32.9 %
:RPS:PFM   12->71 PF00403 * HMA 4e-06 35.0 %
:HMM:PFM   11->72 PF00403 * HMA 4.5e-15 27.4 62/62  
:BLT:SWISS 7->71 COPZ_STAAR 3e-10 36.9 %
:PROS 14->43|PS01047|HMA_1

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54234.1 GT:GENE BAF54234.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1375216..1375452 GB:FROM 1375216 GB:TO 1375452 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54234.1 LENGTH 78 SQ:AASEQ MTSPNTLKQTTLRSDEFSCPSCVSKIENKLNGLDGVDNAEVKFSSGRILVDHDPSKVSIKDLVAAVAEVGYTAKPSAI GT:EXON 1|1-78:0| BL:SWS:NREP 1 BL:SWS:REP 7->71|COPZ_STAAR|3e-10|36.9|65/68| PROS 14->43|PS01047|HMA_1|PDOC00804| BL:PDB:NREP 1 BL:PDB:REP 7->71|2qifB|1e-10|36.9|65/68| RP:PDB:NREP 1 RP:PDB:REP 7->75|3cjkB|8e-16|24.6|69/75| RP:PFM:NREP 1 RP:PFM:REP 12->71|PF00403|4e-06|35.0|60/62|HMA| HM:PFM:NREP 1 HM:PFM:REP 11->72|PF00403|4.5e-15|27.4|62/62|HMA| GO:PFM:NREP 2 GO:PFM GO:0030001|"GO:metal ion transport"|PF00403|IPR006121| GO:PFM GO:0046872|"GO:metal ion binding"|PF00403|IPR006121| RP:SCP:NREP 1 RP:SCP:REP 8->75|1aw0A|2e-15|27.9|68/72|d.58.17.1| HM:SCP:REP 7->79|1k0vA_|7.8e-16|32.9|73/0|d.58.17.1|1/1|HMA, heavy metal-associated domain| OP:NHOMO 24 OP:NHOMOORG 20 OP:PATTERN ----------------------------------1-----------------------1--------- -------1222-----------------------------------112-------1-----1-------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------1---------------------------------------------1----------------------------------------1----------------------------1------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------1------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 78 STR:RPRED 100.0 SQ:SECSTR ccccTTcEEEEEEEcccccHHHHHHHHHHHHTcTTEEEEEEETTTTEEEEEEcTTTccHHHHHHHHHHTTccEEEccE DISOP:02AL 1-6,77-77| PSIPRED ccccccEEEEEEEEccccHHHHHHHHHHHHHccccEEEEEEEEcccEEEEEEccccccHHHHHHHHHHccccEEEccc //