[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54243.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  33/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:230 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   18->93 2dk8A PDBj 2e-05 8.6 %
:RPS:SCOP  19->77 2dk5A1  a.4.5.85 * 3e-05 20.3 %
:HMM:SCOP  2->110 2d1hA1 a.4.5.50 * 4.1e-06 15.6 %
:HMM:PFM   27->64 PF09339 * HTH_IclR 2e-05 28.9 38/52  
:BLT:SWISS 14->125 Y3825_BACHD 2e-04 40.2 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54243.1 GT:GENE BAF54243.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1387603..1388295) GB:FROM 1387603 GB:TO 1388295 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54243.1 LENGTH 230 SQ:AASEQ MTTQTAPTAATDLFAESYKLSPKQREVLDALQTFPDGARAIDVAKKLDLHVNTARGHLEELVAKEAIRVVTAAAKGRGRPSLIFQTRVPDNRAVAKEYITLIELMANMLGDVDDDAMHNPELRAKALSIGTQWAHVMGIKHAEAEDLDEALSPLINRLREMGFDPTETEEANSLALHSCPFVVNDKRPSAFVCAIHAGFIQESLGENNRIQLELKPLNAPGTCKVHVFSE GT:EXON 1|1-230:0| BL:SWS:NREP 1 BL:SWS:REP 14->125|Y3825_BACHD|2e-04|40.2|97/249| RP:PDB:NREP 1 RP:PDB:REP 18->93|2dk8A|2e-05|8.6|70/81| HM:PFM:NREP 1 HM:PFM:REP 27->64|PF09339|2e-05|28.9|38/52|HTH_IclR| RP:SCP:NREP 1 RP:SCP:REP 19->77|2dk5A1|3e-05|20.3|59/78|a.4.5.85| HM:SCP:REP 2->110|2d1hA1|4.1e-06|15.6|109/0|a.4.5.50|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 38 OP:NHOMOORG 33 OP:PATTERN -------------------------------------------------------------------- -----121111----1111-11--121111111111--111-------2------------131-1----1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 148 STR:RPRED 64.3 SQ:SECSTR HHHHHHHHHHHTccHHcccHHHHHHHHHHHHHHccccEEHHHHHHHcTccHHHHHHHHHHHHHHTcEEEcccTTEEEccccEEEEEcccccccccHHHHHHHHHHHTTcTTEEEEEEccccc########cEEEEEEEEc##cHHHHHHHHHHHHHTc######################################################################## DISOP:02AL 1-8,69-69,72-77,81-81,140-144| PSIPRED ccccccccHHHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEEccccccccHHEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccccEEcccccEEEEEccHHHHHHHHcHHHHHHHHHHHHHHHHccccccEEEEEccccccEEEEEEEcc //