[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54260.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  67/68 : Bacteria  825/915 : Eukaryota  147/199 : Viruses  0/175   --->[See Alignment]
d.115.1
:216 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   17->209 2eqaA PDBj 7e-26 30.4 %
:RPS:PDB   1->105 3c9dA PDBj 2e-11 10.5 %
:RPS:PDB   125->203 2e6gH PDBj 1e-15 9.3 %
:RPS:SCOP  4->209 1jcuA  d.115.1.1 * 1e-49 29.1 %
:HMM:SCOP  2->209 1jcuA_ d.115.1.1 * 6.9e-60 40.5 %
:RPS:PFM   22->197 PF01300 * Sua5_yciO_yrdC 1e-29 44.9 %
:HMM:PFM   23->197 PF01300 * Sua5_yciO_yrdC 2.2e-53 41.1 175/179  
:BLT:SWISS 1->215 Y1301_MYCTU 3e-75 62.3 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54260.1 GT:GENE BAF54260.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1412165..1412815 GB:FROM 1412165 GB:TO 1412815 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54260.1 LENGTH 216 SQ:AASEQ MSRIYDCADQDSRAAGLKAAVDAVKAGQLVVLPTDTLYGLGCDAFNNEAVANLLATKHRGPDMPVPVLVGSWDTIQGLVHSYSAQAKALVEAFWPGGLSIIVPQAPSLPWNLGDTRGTVMLRMPLHPVAIELLRQTGPMAVSSANISGHTPPSTVLEARQQLNQNVSVYLDGGECAIGKPSTIVDISGPAPKILREGAISAERVGEVLGVSAESLR GT:EXON 1|1-216:0| BL:SWS:NREP 1 BL:SWS:REP 1->215|Y1301_MYCTU|3e-75|62.3|215/217| BL:PDB:NREP 1 BL:PDB:REP 17->209|2eqaA|7e-26|30.4|191/327| RP:PDB:NREP 2 RP:PDB:REP 1->105|3c9dA|2e-11|10.5|105/208| RP:PDB:REP 125->203|2e6gH|1e-15|9.3|75/229| RP:PFM:NREP 1 RP:PFM:REP 22->197|PF01300|1e-29|44.9|176/178|Sua5_yciO_yrdC| HM:PFM:NREP 1 HM:PFM:REP 23->197|PF01300|2.2e-53|41.1|175/179|Sua5_yciO_yrdC| RP:SCP:NREP 1 RP:SCP:REP 4->209|1jcuA|1e-49|29.1|203/208|d.115.1.1| HM:SCP:REP 2->209|1jcuA_|6.9e-60|40.5|205/208|d.115.1.1|1/1|YrdC/RibB| OP:NHOMO 1318 OP:NHOMOORG 1039 OP:PATTERN 11111111111111111111111111111111111111111111111111111111111111111-11 2221111111111111111-11111111111111111211111122211111121111113312222112211111111111---111111111111---2221121212111111111111111111111111111111111111232222222111-1--1222222211-11111-11-1-1-111111111111111111111111111111111111111111111111222222122222211111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111211111-11111111111111111111111111111-11-11-11111-11111121111111111111111111111111111111111111111111111111111111111-111111111111111112222222111122221111122222222-1222111111112112222212311111111222112122221111-1111111111111122122212-------------------------221121221211-21111111111211112111--22111-----21222212222222222-22222222222222222222222122222222222222222222222222221222222222222111-222222222122111111121111112212222222-112222222122322222222---------11221222221222211111111111111--21111111131111111-11111---1--------------1-11111111111111 111111--211111121111111111111111111111-11-11-111111111--1--111111111-1-11111111111111111-121111111111211111121734322------------------------1--1---1-----1121131221231111111112111-1-2-1-11211--2121111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 209 STR:RPRED 96.8 SQ:SECSTR EEEEEcccTTTcccEEEEEEEEEEcccEEEEccccccccGGGTTTcTTTcccTTcHHHHHHHHHHHTcHHHHTTTTcccTTHHHHHHHHHHTHHHHHHHHHHHHHTTccHHHHTTccEEEEEccHHHHHHHHTTccEEEcEEcccccccccEEEEEcccccTTcccEEEEEccHHccccHHHHHHHHHcccccEEEEEEEEccHHHHcT####### DISOP:02AL 216-217| PSIPRED ccEEEEEccccccHHHHHHHHHHHHcccEEEEEcccEEEEEEccccHHHHHHHHHHHcccccccEEEEEccHHHHHHHHHHccHHHHHHHHHHccccEEEEEEccccccHHHcccccEEEEEEcccHHHHHHHHHcccEEEEccccccccccccHHHHHHHHcccccEEEEccccccccccEEEEEEcccEEEEEcccccHHHHHHHHcccHHHcc //