[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54274.1
DDBJ      :             hypothetical protein
Swiss-Prot:Y1294_CORGB  RecName: Full=UPF0286 protein cgR_1294;

Homologs  Archaea  36/68 : Bacteria  71/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.52.1
:230 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   4->210 2vldB PDBj 2e-15 32.3 %
:RPS:SCOP  98->220 2inbA1  c.52.1.32 * 2e-10 18.2 %
:RPS:PFM   3->217 PF01939 * DUF91 2e-82 72.8 %
:HMM:PFM   2->230 PF01939 * DUF91 4.1e-81 38.5 221/228  
:BLT:SWISS 1->230 Y1294_CORGB e-132 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54274.1 GT:GENE BAF54274.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1423038..1423730 GB:FROM 1423038 GB:TO 1423730 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54274.1 LENGTH 230 SQ:AASEQ MRLVIARCSVDYVGRLEAHLPSADRLLMVKADGSVSIHADDRAYKPLNWMTPPCSLVETPITDEDGEATGESLWVVENKKGEQLRITVEKIHSEQNFDLGEDPGLVKDGVEDHLQELLAEHITTLGDGYTLIRREYPTAIGPVDILCRNSDGETVAVEIKRRGGIDGVEQLTRYLELLNRDELLKPVHGVFAAQEIKPQAKTLAEDRGIKCVTLDYQALRGIESNELTLF GT:EXON 1|1-230:0| SW:ID Y1294_CORGB SW:DE RecName: Full=UPF0286 protein cgR_1294; SW:GN OrderedLocusNames=cgR_1294; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->230|Y1294_CORGB|e-132|100.0|230/230| BL:PDB:NREP 1 BL:PDB:REP 4->210|2vldB|2e-15|32.3|186/222| RP:PFM:NREP 1 RP:PFM:REP 3->217|PF01939|2e-82|72.8|206/213|DUF91| HM:PFM:NREP 1 HM:PFM:REP 2->230|PF01939|4.1e-81|38.5|221/228|DUF91| RP:SCP:NREP 1 RP:SCP:REP 98->220|2inbA1|2e-10|18.2|99/128|c.52.1.32| OP:NHOMO 108 OP:NHOMOORG 107 OP:PATTERN 11--11--11111111111--11-11111111111-1-----------------1111111------- ----111111111111111-11111111111111111111111111111111111111--111111111111111111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 186 STR:RPRED 80.9 SQ:SECSTR ###EEEEEEEEEEcccEEEEEEEEEEEEEcTTccEEEE#ccccccccEEE#cTTcEE##########EEccEEEEEcccccEEEEEEEEEEEEEEEE#######ccccccccHHHHHHHHcGGGTcTTcEEEEEEEEETTEEEEEEE#cTTccEEEEEEccccccHHHHHHHHHHHHH#HHHHcccEEEEEEEccccHHHHHHHHHHTcE#################### PSIPRED cEEEEEEEEEEEEEccEEEcccccEEEEEEccccEEEEEccccccccccccccccEEEEccccccccccccEEEEEEEcccEEEEEEEEEEEEEEEEEEccccccHHHHHHHHHHHHHHHcHHHccccEEEEEEEEEccccEEEEEEEcccccEEEEEEEccccccHHHHHHHHHHHHHcccccccEEEEEEcccccHHHHHHHHHccccEEEEcHHHccccccccEEEc //