[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54281.1
DDBJ      :             hypothetical protein
Swiss-Prot:SSUB_CORGL   RecName: Full=Aliphatic sulfonates import ATP-binding protein ssuB;         EC=3.6.3.-;

Homologs  Archaea  68/68 : Bacteria  908/915 : Eukaryota  197/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:243 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   18->215 2it1B PDBj 2e-31 39.4 %
:RPS:PDB   13->234 3dmdC PDBj 1e-45 12.4 %
:RPS:SCOP  13->238 1b0uA  c.37.1.12 * 2e-43 35.1 %
:HMM:SCOP  8->230 1g2912 c.37.1.12 * 3.5e-59 43.5 %
:RPS:PFM   50->156 PF00005 * ABC_tran 3e-19 50.5 %
:HMM:PFM   50->157 PF00005 * ABC_tran 1.4e-22 40.8 103/118  
:HMM:PFM   21->67 PF03193 * DUF258 2.9e-06 30.4 46/161  
:BLT:SWISS 1->243 SSUB_CORGL e-131 97.5 %
:PROS 130->144|PS00211|ABC_TRANSPORTER_1

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54281.1 GT:GENE BAF54281.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1428071..1428802 GB:FROM 1428071 GB:TO 1428802 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54281.1 LENGTH 243 SQ:AASEQ MTATLSLKPAAIVRGLRKSYGTKEVLQGIDLTINRGEVTALIGRSGSGKSTILRVLAGLSKEHSGSVEISGDPAVAFQEPRLLPWKTVLDNVAFGLNRTDISWSEAQERASALLAEVNLPDSDAAWPLTLSGGQAQRVSLARALISEPELLLLDEPFGALDALTRLTAQDLLLKTVNTRNLGVLLVTHDVSEAIALADHVLLLDDGSITHSLTVDIPGDRRTHPSFASYTAQLLEWLEITTPA GT:EXON 1|1-243:0| SW:ID SSUB_CORGL SW:DE RecName: Full=Aliphatic sulfonates import ATP-binding protein ssuB; EC=3.6.3.-; SW:GN Name=ssuB; OrderedLocusNames=Cgl1222, cg1379; SW:KW ATP-binding; Cell membrane; Complete proteome; Hydrolase; Membrane;Nucleotide-binding; Transport. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->243|SSUB_CORGL|e-131|97.5|243/243| GO:SWS:NREP 6 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 130->144|PS00211|ABC_TRANSPORTER_1|PDOC00185| BL:PDB:NREP 1 BL:PDB:REP 18->215|2it1B|2e-31|39.4|198/361| RP:PDB:NREP 1 RP:PDB:REP 13->234|3dmdC|1e-45|12.4|218/318| RP:PFM:NREP 1 RP:PFM:REP 50->156|PF00005|3e-19|50.5|107/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 50->157|PF00005|1.4e-22|40.8|103/118|ABC_tran| HM:PFM:REP 21->67|PF03193|2.9e-06|30.4|46/161|DUF258| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 13->238|1b0uA|2e-43|35.1|225/258|c.37.1.12| HM:SCP:REP 8->230|1g2912|3.5e-59|43.5|223/240|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 54626 OP:NHOMOORG 1173 OP:PATTERN UUNBNJKLVVURWQZPnMNTMRRXvOSmoYhXKBEEFDIGIFEWYSVgOQ**iASeQUYMPLJGZ19A ShvL*jghssuXjXdZaUU-UqDDZ*UUUUUSzwwy****W*g****lzynU***TamFF***s*z****gdddd*ecbS*jmCCDACTTQO6RGKG--FIXONMfPcSTAABBBBADDDDDDDLUPNUaQOVVYTluu**MKL*V*op*llpinXZRLQNSMfjbn***cLXNOIKHXIPKGmaeSOnfCah*************************iry**pu***xyy**cllnnnlkmmlllmlahdcg*lek**kQfcq*zTU**gXVcnpnjnqpsywn**xvu*wurrxzsuwfffedggghgfde*spgfgsrumi*z*********i*nt***bnnk*qkyr*nrSO**toceirTckcolQdgdLhdbbSLPPMOjd***aUy****************-v**uo*s***ZD**************MQO**********babbbbbb*dhRalh*776666665488A8CD89AA9799886A6JGGJHJ************************y********CQ**y*pxpv******frqTdMTubLMMKNLLTTRhqhf**ThZwnZovecuLedcVYXlZaebadz*Y*KKMQGOOOPMIDCDGGDFDEJUGGKRQvu*U*VfPXP*VXbdYSWjZWXZabeeage6-FPXTQ211333****f************-************************prntunpqrrtsrppsppn*ztw****U5************44HIFIFFGNOOORP*r*ccbdbaIRVPPVQViQSUSSHWKRXuf********x****k***HFEDDGFDFNmts*vxwwx*****RTXUTVUTWUHGGG87MVWVPQPQ9A967768*DaCDCCD-FFGCJGCNOMAHLBDD889dloVVm*ljlFgQ 1356ieM-pOBCTcZPNPLISXRcUcPMMGKHKTVRIQLNLLMGGFUTSaURiZNMTHLNOOGBEACB3CD7GEGDC3ABBCBBEC6A-PODNHHEBBBKF6HPOG6Von*fqawmwMIGGMbO*tE*H**x3*a*OPKCmHP*fEQHGBkFD*IhVVyLp*P*VcI*jn*oklYIJKL*NOKNL*qt*M**UO*v*ue ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7,240-244| PSIPRED cccccccccEEEEEEEEEEEccEEEEEccEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEEEEEccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHcccHHHccHHHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHHHHHHHccEEEEEEccHHHHHHHccEEEEEEccEEEEEEcccccccccccHHHHHHHHHHHHHHcccccc //