[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54282.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  7/68 : Bacteria  295/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.1.19c.94.1
:319 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   41->202 3e4rA PDBj 9e-28 40.7 %
:RPS:PDB   33->302 1eexA PDBj 8e-25 11.0 %
:RPS:SCOP  33->302 1dioA  c.1.19.3 * 3e-25 11.0 %
:HMM:SCOP  37->260 1xs5A_ c.94.1.1 * 2.1e-45 30.9 %
:RPS:PFM   67->198 PF09084 * NMT1 3e-16 43.8 %
:HMM:PFM   78->254 PF09084 * NMT1 9.9e-16 23.4 175/216  
:BLT:SWISS 37->221 SSUA_ECOLI 7e-33 43.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54282.1 GT:GENE BAF54282.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1428812..1429771 GB:FROM 1428812 GB:TO 1429771 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54282.1 LENGTH 319 SQ:AASEQ MKFKKIALVLAFGLGLASCSSASGDPATNADGSIDLSKVTLNIGDQIAGTEQVLQASGELDDVPYKIEWSSFTSGPPQIEALNAGQIDFAITGNTPPIIGGPTNTKVVSAYNNDALGDVILVAPDSSITSVADLAGKKVAVARGSSAHGHLIQQLEKAGVSVDDVEINLLQPSDAKAAFQNGQVDAWAVWDPYSSQAELEGAQVLVRGAGLVSGHGFGVASDEALDDPAKEAALADFLDRVADSYEWAEDNTDEWATIFSQESGFDPEASQLNTRSLRHQVPLDELVNTYQNALIDAFVSAGLVEDFNFEDTVDTRFEG GT:EXON 1|1-319:0| BL:SWS:NREP 1 BL:SWS:REP 37->221|SSUA_ECOLI|7e-33|43.8|185/319| TM:NTM 1 TM:REGION 6->26| SEG 10->24|lafglglascssasg| BL:PDB:NREP 1 BL:PDB:REP 41->202|3e4rA|9e-28|40.7|162/291| RP:PDB:NREP 1 RP:PDB:REP 33->302|1eexA|8e-25|11.0|263/551| RP:PFM:NREP 1 RP:PFM:REP 67->198|PF09084|3e-16|43.8|128/200|NMT1| HM:PFM:NREP 1 HM:PFM:REP 78->254|PF09084|9.9e-16|23.4|175/216|NMT1| RP:SCP:NREP 1 RP:SCP:REP 33->302|1dioA|3e-25|11.0|263/551|c.1.19.3| HM:SCP:REP 37->260|1xs5A_|2.1e-45|30.9|223/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 817 OP:NHOMOORG 303 OP:PATTERN ---------------------------------1---------1---11-1--1-------------1 ----2---111---332----1---7------22224253-21221---11-12------------14241-------------------------------------------------------------------------1-------1------1-------6-5--------------11-----1-11111111111111115-11-111-1-2-----------3------------------------11---------11----1---------------------------------------11---111-1---1-----------211-----11-------11-1-----3----------1--------9475B-214-12211111111111-9838827A-3--84451-23523254----12-4--1-111111111----12----------------------------------1-1-31226BBAB5311118876333312A6A6461--552-21--34-281-5--1-11------------11-----1----1-----21---1-------7---1-------------------------1---2-1---1-------------------------1------3221-222222221222-222222222222222222255533-------------------22222212--122122212222-----------------------------1---5554523---E18738255737732-666--------------------------2--------------2------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 293 STR:RPRED 91.8 SQ:SECSTR #########################ccccHHHHHHHHTTcEEEEEccTTHHHHTTccTTccHHHHHHHHHHHHHHHTccEEEcccGGGTTTGGGcTTHHHHHHHHHHHHTTcEEEccccccccccHHHHHHHHHHHHTTccccccEEEEcccGGGTTccccccGGGHHHHHHHHHHHTccHHHHHHHHHHHHHHHHHHHHHTcccccHHHHHHHHHcccGGGcccccHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHTTcHHHHHHHHHHHHHcGGGcTTcEEETTTEEEcTTTccccccccccHHHHccHHHc# DISOP:02AL 1-1,24-32| PSIPRED ccHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEEccccccHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHcccEEEEEEccHHHHHHccccccEEEEEEcccccEEEEEEcccccccHHHHcccEEEEccccHHHHHHHHHHHHccccHHHEEEEEccHHHHHHHHHcccccEEEEccHHHHHHHHccccEEEEccccccccEEEEEEHHHHHccccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHcccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHccccccccHHHHHcccccc //