[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54291.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:104 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   24->77 PF09426 * Nyv1_N 0.0003 23.1 52/141  
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54291.1 GT:GENE BAF54291.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1441130..1441444) GB:FROM 1441130 GB:TO 1441444 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54291.1 LENGTH 104 SQ:AASEQ MIKKYLSTIAAVTIASAVLFAPIAQANTISSHFPEHDMVDPYGPTMTSTGLNRSQETVMFHGLFGAIVLSTGSPVVGDCQNVPLSHQQVICPLATELHYAIYGR GT:EXON 1|1-104:0| TM:NTM 2 TM:REGION 5->27| TM:REGION 55->77| HM:PFM:NREP 1 HM:PFM:REP 24->77|PF09426|0.0003|23.1|52/141|Nyv1_N| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cHHHHHHHHHHHHHHHHHHHccccccccHHHccccccccccccccccccccccccHHHHHHHHHHHHHHcccccEEcccccccccccEEEccHHHHEEHHHccc //