[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54301.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  37/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
c.55.3
:237 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   18->216 3cg7B PDBj 1e-22 16.7 %
:RPS:SCOP  13->188 1j9aA  c.55.3.5 * 3e-21 18.3 %
:HMM:SCOP  12->192 2f96A1 c.55.3.5 * 1.2e-29 31.1 %
:HMM:PFM   21->177 PF00929 * Exonuc_X-T 2.4e-15 25.8 151/165  
:BLT:SWISS 22->218 DPO3_OCEIH 3e-08 28.4 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54301.1 GT:GENE BAF54301.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1450250..1450963) GB:FROM 1450250 GB:TO 1450963 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54301.1 LENGTH 237 SQ:AASEQ MNSPSNPAPTVPSFDTTKMLSFDLETTGVNPFDTRIVTSAMVTITSKGAEPIELLADPGIEIPEAATAVHGITTEHARANGRPHDEVLAETISRLRAGWQAGLSVIVFNASYDLTVLRNHDPSFTIDGLVYDPFVIDKVKDRYRKGKRTLTDMCAHYDVQLGNAHEATSDALAAARIAWKQVRLWPELTKMTGEELMEFQAVNYYEQQKSFRSYLIGQGRDASDVNTSWPVQTDPAS GT:EXON 1|1-237:0| BL:SWS:NREP 1 BL:SWS:REP 22->218|DPO3_OCEIH|3e-08|28.4|183/1428| RP:PDB:NREP 1 RP:PDB:REP 18->216|3cg7B|1e-22|16.7|198/295| HM:PFM:NREP 1 HM:PFM:REP 21->177|PF00929|2.4e-15|25.8|151/165|Exonuc_X-T| RP:SCP:NREP 1 RP:SCP:REP 13->188|1j9aA|3e-21|18.3|169/184|c.55.3.5| HM:SCP:REP 12->192|2f96A1|1.2e-29|31.1|177/0|c.55.3.5|1/1|Ribonuclease H-like| OP:NHOMO 41 OP:NHOMOORG 38 OP:PATTERN -------------------------------------------------------------------- ----1111111111----------------------1111---1-11-1111111111------1--2221----------------------1--------1-1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------- STR:NPRED 229 STR:RPRED 96.6 SQ:SECSTR HHHHHHHccccccccGGEEEEEEEEEcccTTccccEEEEEEEEEETTTTEEEEccccccccccHHHHHHHcccHHHHHHTcccHHHHHHHHHHHHHTTccTTcEEEEEcccHHHHTHHHHHHHHTTccccGGGcEEEEHHHHHHHcccHHHHHHHHHTcccccTTcHHHHHHHHHHHHHHHHHTTccccccEEEEcccGGGGccccccTTGGGcHHcGGGcGGGTTEEE######## DISOP:02AL 1-12,235-238| PSIPRED ccccccccccccccccccEEEEEEccccccccccEEEEEEEEEEEcccEEEEEEEEcccccccHHHHHHHcccHHHHHHccccHHHHHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHHHHccccHHHccHHHHHHHHHHcccccccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccEEEEEEEccccccccccccccccccc //