[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54313.1
DDBJ      :             hypothetical protein
Swiss-Prot:RBSD_CORGB   RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;

Homologs  Archaea  0/68 : Bacteria  198/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.133.1
:123 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->123 1ogdA PDBj 5e-13 35.0 %
:RPS:PDB   1->123 3e7nB PDBj 2e-27 35.2 %
:RPS:SCOP  1->123 1ogcA  c.133.1.1 * 7e-12 35.0 %
:HMM:SCOP  1->123 1ogcA_ c.133.1.1 * 1.1e-37 47.2 %
:RPS:PFM   1->121 PF05025 * RbsD_FucU 3e-15 41.9 %
:HMM:PFM   1->123 PF05025 * RbsD_FucU 1.6e-38 48.0 123/142  
:BLT:SWISS 1->123 RBSD_CORGB 2e-50 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54313.1 GT:GENE BAF54313.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1463738..1464109 GB:FROM 1463738 GB:TO 1464109 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54313.1 LENGTH 123 SQ:AASEQ MKKSGLLNPDLCYAIARLGHTDTWAVADCGLPIPEHVEIIDLALVFGIPTFEQVLNALKPEVVVEGAVIAEGTPERIREMVDTDVEVVTHEELKAQLAECAFVIRTGETTAYANVIFKSGVAF GT:EXON 1|1-123:0| SW:ID RBSD_CORGB SW:DE RecName: Full=D-ribose pyranase; EC=5.5.1.n1; SW:GN Name=rbsD; OrderedLocusNames=cgR_1332; SW:KW Carbohydrate metabolism; Complete proteome; Cytoplasm; Isomerase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->123|RBSD_CORGB|2e-50|100.0|123/123| GO:SWS:NREP 3 GO:SWS GO:0005975|"GO:carbohydrate metabolic process"|Carbohydrate metabolism| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016853|"GO:isomerase activity"|Isomerase| SEG 61->72|evvvegaviaeg| SEG 79->92|emvdtdvevvthee| BL:PDB:NREP 1 BL:PDB:REP 1->123|1ogdA|5e-13|35.0|123/131| RP:PDB:NREP 1 RP:PDB:REP 1->123|3e7nB|2e-27|35.2|122/137| RP:PFM:NREP 1 RP:PFM:REP 1->121|PF05025|3e-15|41.9|117/135|RbsD_FucU| HM:PFM:NREP 1 HM:PFM:REP 1->123|PF05025|1.6e-38|48.0|123/142|RbsD_FucU| GO:PFM:NREP 1 GO:PFM GO:0008643|"GO:carbohydrate transport"|PF05025|IPR007721| RP:SCP:NREP 1 RP:SCP:REP 1->123|1ogcA|7e-12|35.0|123/131|c.133.1.1| HM:SCP:REP 1->123|1ogcA_|1.1e-37|47.2|123/131|c.133.1.1|1/1|Ribose transport protein RbsD| OP:NHOMO 199 OP:NHOMOORG 198 OP:PATTERN -------------------------------------------------------------------- --------111----------------------------------------------------1----11------------1-----------------------------------------------------1------------------------------------------------------11111111111111111111111-111-11-111-------11-----------------11111-11-1---1111-11-1--11-1111-1-1------------------------------------1------------1-1----1----1-1----1--------1--111-1----1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----------------------1-------------------------------------------------12-------1-------1------1------------------11111-1111111111-11111111111111-11-111111-111111111111111111111-1111--111111111111------------------1111---11111111----------------1111-1111-111----------11111111111111---------------------------------------------------------------1-------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 123 STR:RPRED 100.0 SQ:SECSTR ccccccccHHHHHHHHHccTTcEEEEEcTTccccTTcEEEEccccTTcccHHHHHHHHEEEEETHHHHHcHHHHHHHHHTcccEEEEEcHHHHHHHHTTccEEEEcccccTTccEEEEEcccc DISOP:02AL 1-1| PSIPRED ccccccccHHHHHHHHHHccccEEEEEEcccccccccEEEEEEEcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccEEccHHHHHHHHHcccEEEEcccccccEEEEEEEcccc //