[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54314.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  300/915 : Eukaryota  45/199 : Viruses  0/175   --->[See Alignment]
d.108.1
:212 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->189 1yreC PDBj 1e-22 37.1 %
:RPS:PDB   60->181 3dnsB PDBj 3e-18 14.8 %
:RPS:SCOP  8->177 2fckA1  d.108.1.1 * 1e-24 15.6 %
:HMM:SCOP  3->179 2fckA1 d.108.1.1 * 2.6e-40 30.3 %
:HMM:PFM   76->153 PF00583 * Acetyltransf_1 4.6e-06 24.7 77/83  
:BLT:SWISS 3->193 YIW2_YEAST 3e-15 33.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54314.1 GT:GENE BAF54314.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1464262..1464900 GB:FROM 1464262 GB:TO 1464900 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54314.1 LENGTH 212 SQ:AASEQ MQFAQNPRLTNDAVILEPLSHQWTQDLQEAVASQELWRHWFVALPTPEGMAEEIDRRLAEHADGLCAPWAIISAATGRAVGMTSFHTLDHANKRLEIGRTWMAAHVQGTGINPSVKFLQLQRAFEDLGVNAVEFRTNWHNHRSRAAIERLGAKQDGVLRKHRIHPDGTVRDTVIYSITNDEWPAVKLTLMERLYRHMQVPIIPNEASLFDAS GT:EXON 1|1-212:0| BL:SWS:NREP 1 BL:SWS:REP 3->193|YIW2_YEAST|3e-15|33.0|188/236| BL:PDB:NREP 1 BL:PDB:REP 9->189|1yreC|1e-22|37.1|175/182| RP:PDB:NREP 1 RP:PDB:REP 60->181|3dnsB|3e-18|14.8|115/125| HM:PFM:NREP 1 HM:PFM:REP 76->153|PF00583|4.6e-06|24.7|77/83|Acetyltransf_1| RP:SCP:NREP 1 RP:SCP:REP 8->177|2fckA1|1e-24|15.6|167/174|d.108.1.1| HM:SCP:REP 3->179|2fckA1|2.6e-40|30.3|175/0|d.108.1.1|1/1|Acyl-CoA N-acyltransferases (Nat)| OP:NHOMO 426 OP:NHOMOORG 345 OP:PATTERN -------------------------------------------------------------------- 13--3--1111----------1---1------1----111-11-1--1111-1121-2--2---1---111----------------------------1-31-12---1-------------------------------------------------------------------------22211---1-22222223213322231----11311-1211-------13111---1-1111111---11----------------------1----------11111111111111-------------1----1------------------------------------------------------2--1111-------11111111111----------1---1----1111-11111111111111121-21----1-1--------111-1-1--------------------------------1-1-111-22222222111122211111-12211111--22111111211121-1--1--211111111--1-------------------------------11-----------------------------11----2----1111131111111111112-------------111111-------------------------------222--111----------------1---------1---------------121111111---2----1-----------111111---1--22221212211111111----------1-11--------211111111111----------1122-----------------------------------------------1- ----11--------1-1--111---1-111111----1111111---1111121--------1---11-------21--11-----------1---------1----1-1---------------------------------------------------------------1-----------1--2------111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 190 STR:RPRED 89.6 SQ:SECSTR ######cccHcTTcEEEEccGGGHHHHHHHHTTTccEEETTEEEccHHHHHHHHHHcTTEEcTTcccEEEEEETTTccEEEEEEEEEEETTTTEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHccccEEEEEEETETTcccHHHHHHTcEEEEEEEEEEEEETTEEEEEEEEEEHHHHHccTcTTEEEcccHH################ DISOP:02AL 1-1,210-213| PSIPRED cccccccEEEccEEEEEEccHHHHHHHHHHHccHHHHHHcccccccHHHHHHHHHHHHHHHHccccEEEEEEEccccEEEEEEEEEEccccccEEEEEEEEEcHHHccccHHHHHHHHHHHHHHHHcccEEEEEEEccccHHHHHHHHHcccEEEEEEEccEEccccEEEEEEEEEEEHHHHHHHHHHHHHHHHHccccccccccccccccc //