[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54319.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  39/68 : Bacteria  593/915 : Eukaryota  178/199 : Viruses  0/175   --->[See Alignment]
c.1.7
:297 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->277 3erpA PDBj 5e-75 59.9 %
:RPS:PDB   2->278 3eb3A PDBj 5e-42 33.2 %
:RPS:SCOP  2->280 1pz1A  c.1.7.1 * 5e-53 27.2 %
:HMM:SCOP  2->286 1lqaA_ c.1.7.1 * 1.7e-64 39.3 %
:RPS:PFM   10->253 PF00248 * Aldo_ket_red 8e-34 41.9 %
:HMM:PFM   2->278 PF00248 * Aldo_ket_red 6.1e-56 36.0 247/284  
:BLT:SWISS 1->291 YGHZ_ECOLI 2e-89 59.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54319.1 GT:GENE BAF54319.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1470138..1471031 GB:FROM 1470138 GB:TO 1471031 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54319.1 LENGTH 297 SQ:AASEQ MANNYGPPAGSAETNFGRILREDLKSHRDELIISSKAGWDMWPGPYGFGGSRKYLMSSLDQSLTRLGLDYVDIFYHHRPDPDTPLEETMYALRDIVASGKALYVGISSYGPELTAEAAEFMAEEGCPLLIHQPSYSIINRWVEEPGDDGENLLQSAANNGLGVIAFSPLAQGLLTDKYLNGIPEGSRASQGKSLSEGMLNVDNIGMVRKLNDIAQERGQSLAQMALAWVLREQGEYGADTVTSALIGASSVEQLDNSLDSLNNLEFSDAELEAIDEISHDAGINIWAKATDSKTREN GT:EXON 1|1-297:0| BL:SWS:NREP 1 BL:SWS:REP 1->291|YGHZ_ECOLI|2e-89|59.3|280/346| SEG 254->268|ldnsldslnnlefsd| BL:PDB:NREP 1 BL:PDB:REP 1->277|3erpA|5e-75|59.9|247/312| RP:PDB:NREP 1 RP:PDB:REP 2->278|3eb3A|5e-42|33.2|262/326| RP:PFM:NREP 1 RP:PFM:REP 10->253|PF00248|8e-34|41.9|215/281|Aldo_ket_red| HM:PFM:NREP 1 HM:PFM:REP 2->278|PF00248|6.1e-56|36.0|247/284|Aldo_ket_red| GO:PFM:NREP 2 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00248|IPR001395| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00248|IPR001395| RP:SCP:NREP 1 RP:SCP:REP 2->280|1pz1A|5e-53|27.2|257/333|c.1.7.1| HM:SCP:REP 2->286|1lqaA_|1.7e-64|39.3|270/0|c.1.7.1|1/1|NAD(P)-linked oxidoreductase| OP:NHOMO 3482 OP:NHOMOORG 810 OP:PATTERN 111-1-113334212-29111-1-42271851----------------------11111115332-1- 55B3O-12333-1-14411-1---2A111111-33337867E6KB9514BA28CC318--8753F2FGED42333344---14--11-3621-3-------5131F-424--------------11-1111--121122331119-334523322111-----111763D4------------66311221624222222222222232323345223122-3214444424I-22222222222222222221-6123111--662244115164121---1------------------------------1--------11--11----------1-------3-1--2-2--------11--12-1---2-28442-----B76541-234212----------5-45445A337B1-IAA9CD9KICA9751513172-224231111111157731133-----------------------------1144232333699989A8444377A8444425D7F1323--11262322432761-31-2-11-----------12211---1----1----2111-131146659D-21-1---------11-1--111--1111116232--4211111122111121111111----111------43461644445455544-434454345445744444499745---3254534334543445633443432-644444444444----------111-1353---3-4-------1-22212231119155352434232353555---------1-111111111111134655553333111---1111111----------1----1-------------1------2222133333173 ------------123D9B9DCGBHIKK3323335324313233222CACMBILJDE9456573-1-1322364153423635551323-OhG9CU96569433A86-2AED7775542342945663D5KX8-A8A-44453463141327218452452321831-2114--112453G3345ADBJH8AH44SGOG2 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 293 STR:RPRED 98.7 SQ:SECSTR ccTTGGGHHGHHHHHHHHHHHHHHTccGGGcEEEEEEEccccccGGGccccHHHHHHHHHHHHHHHTcccEEEEEEccccTTccHHHHHHHHHHHHHTTcEEEEEEEcccHHHHHHHHHHHHHTTccccEEEEEccTTccHHHHHHGGGHHHHHHHHHHccEEEEEcTTGGGGGGTTTTTcccTTcGGGHHHHHHHcHHHHHHHHHHHHHHHHHHHHTccHHHHHHHHHHccTTccGGTTEEEEEEccccHHHHHHHHGGGGTGGGccHHHHHHHHHHGGGcccccHHHHHHH#### DISOP:02AL 291-298| PSIPRED cccccccccccHHHHHHHHHHHHccccHHEEEEEcccccccccccccccccHHHHHHHHHHHHHHHcccEEEEEEEEcccccccHHHHHHHHHHHHHcccEEEEEEEcccHHHHHHHHHHHHHccccEEEEEccccccccHHHcccccHHHHHHHHHHHccEEEEEcccccccccccccccccccccccccccccHHcccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccccccccEEEEEccccHHHHHHHHHHHHcccccHHHHHHHHHHHccccccccccccccccccc //