[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54331.1
DDBJ      :             hypothetical protein
Swiss-Prot:ILVC_CORGL   RecName: Full=Ketol-acid reductoisomerase;         EC=1.1.1.86;AltName: Full=Acetohydroxy-acid isomeroreductase;AltName: Full=Alpha-keto-beta-hydroxylacil reductoisomerase;

Homologs  Archaea  52/68 : Bacteria  733/915 : Eukaryota  111/199 : Viruses  0/175   --->[See Alignment]
a.100.1c.127.1c.2.1d.58.56
:338 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->329 1np3A PDBj 6e-96 51.4 %
:RPS:PDB   17->332 3db2C PDBj 4e-29 10.8 %
:RPS:SCOP  7->102 2a10A1  d.58.56.1 * 3e-19 21.7 %
:RPS:SCOP  85->283 1qv9A  c.127.1.1 * 1e-51 15.6 %
:HMM:SCOP  3->184 1np3A2 c.2.1.6 * 1.3e-69 60.4 %
:HMM:SCOP  185->329 1qmgA1 a.100.1.2 * 4.2e-63 59.0 %
:RPS:PFM   15->169 PF07991 * IlvN 1e-53 62.6 %
:RPS:PFM   185->328 PF01450 * IlvC 1e-44 58.7 %
:HMM:PFM   16->179 PF07991 * IlvN 1.9e-75 62.2 164/165  
:HMM:PFM   185->330 PF01450 * IlvC 3e-60 57.2 145/145  
:BLT:SWISS 1->338 ILVC_CORGL 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54331.1 GT:GENE BAF54331.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1483488..1484504 GB:FROM 1483488 GB:TO 1484504 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54331.1 LENGTH 338 SQ:AASEQ MAIELLYDADADLSLIQGRKVAIVGYGSQGHAHSQNLRDSGVEVVIGLREGSKSAEKAKEAGFEVKTTAEAAAWADVIMLLAPDTSQAEIFTNDIEPNLNAGDALLFGHGLNIHFDLIKPADDIIVGMVAPKGPGHLVRRQFVDGKGVPCLIAVDQDPTGTAQALTLSYAAAIGGARAGVIPTTFEAETVTDLFGEQAVLCGGTEELVKVGFEVLTEAGYEPEMAYFEVLHELKLIVDLMFEGGISNMNYSVSDTAEFGGYLSGPRVIDADTKSRMKDILTDIQDGTFTKRLIANVENGNTELEGLRASYNNHPIEETGAKLRDLMSWVKVDARAETA GT:EXON 1|1-338:0| SW:ID ILVC_CORGL SW:DE RecName: Full=Ketol-acid reductoisomerase; EC=1.1.1.86;AltName: Full=Acetohydroxy-acid isomeroreductase;AltName: Full=Alpha-keto-beta-hydroxylacil reductoisomerase; SW:GN Name=ilvC; OrderedLocusNames=Cgl1273, cg1437; SW:KW Amino-acid biosynthesis; Branched-chain amino acid biosynthesis;Complete proteome; NADP; Oxidoreductase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->338|ILVC_CORGL|0.0|100.0|338/338| GO:SWS:NREP 4 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0009082|"GO:branched chain family amino acid biosynthetic process"|Branched-chain amino acid biosynthesis| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| SEG 170->179|aaaiggarag| BL:PDB:NREP 1 BL:PDB:REP 3->329|1np3A|6e-96|51.4|327/327| RP:PDB:NREP 1 RP:PDB:REP 17->332|3db2C|4e-29|10.8|316/339| RP:PFM:NREP 2 RP:PFM:REP 15->169|PF07991|1e-53|62.6|155/165|IlvN| RP:PFM:REP 185->328|PF01450|1e-44|58.7|143/145|IlvC| HM:PFM:NREP 2 HM:PFM:REP 16->179|PF07991|1.9e-75|62.2|164/165|IlvN| HM:PFM:REP 185->330|PF01450|3e-60|57.2|145/145|IlvC| GO:PFM:NREP 6 GO:PFM GO:0004455|"GO:ketol-acid reductoisomerase activity"|PF07991|IPR013116| GO:PFM GO:0008652|"GO:cellular amino acid biosynthetic process"|PF07991|IPR013116| GO:PFM GO:0055114|"GO:oxidation reduction"|PF07991|IPR013116| GO:PFM GO:0004455|"GO:ketol-acid reductoisomerase activity"|PF01450|IPR000506| GO:PFM GO:0009082|"GO:branched chain family amino acid biosynthetic process"|PF01450|IPR000506| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01450|IPR000506| RP:SCP:NREP 2 RP:SCP:REP 7->102|2a10A1|3e-19|21.7|83/104|d.58.56.1| RP:SCP:REP 85->283|1qv9A|1e-51|15.6|180/282|c.127.1.1| HM:SCP:REP 3->184|1np3A2|1.3e-69|60.4|182/0|c.2.1.6|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 185->329|1qmgA1|4.2e-63|59.0|144/288|a.100.1.2|1/1|6-phosphogluconate dehydrogenase C-terminal domain-like| OP:NHOMO 968 OP:NHOMOORG 896 OP:PATTERN ---1--1122222231-11111111--11111111111111111121111111111-----1--1-11 1111111111111111111-111111111111111111111111111-111111111111112111112112111222-11-111111111111---11--111111111---------------11111111111111111111111111111111111111111111111111111111111111111-11122222222122222211111122211111--1111111111111111111111111111---------------------1-111-------11111111111111-------------111111111-11-11-------1-111221---1-1--111111111111-111111--1-11111111111111111111111111111111111-11111111111-111111111111111121111111111111111111111111111---------------------------11111111111111111122211111222212111111111111111111111111111111111111111111111-1111111111111-1111111111111-1121111111111111111111111111111111111-1111111111111111111111-1-111111111111111111111111111-1111111111111111111111111111111111111111111111111111-11111111111111-----------11111211111-11111111111111111111111111111111111111-1-1111-111111111111111111111111111111111111111--------------------------------------1--1-111121 --------------1111111111111-1111111111-1111-1111111111111-1111111111-11111111-1111111111-24211211111111212--1----------------------------------------------------------------1-1111B1111122231111111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 334 STR:RPRED 98.8 SQ:SECSTR HHTTccHHHHHcccHcccEEEEEEcccHHHHHHHHHTTcTTEEEEEEEcccHHHHHHHHHHHTcEEcccHHHHTcTTccEEEcccGGHHHHHTTcEEEEEccccccHHHHHHHHHHHHHHcccEEEEcGGGGcHHHHHHHHHTTTTccEEEEEEEEEccHHHHccTTcGGGcTTTcTTTHHHHTHHHHHHHHHHccEEEEEEEEEcccccccccEEEEEEEETTEEEEEEcccccEEEEEEEEccEEEEEEEcGGGcccTTTGGGGEEEEEEEEccccEEEEEEcccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHTccEEHHcc#### DISOP:02AL 1-1,336-339| PSIPRED cccEEEccccccccHHcccEEEEEccccHHHHHHHHHHHcccEEEEEEEcccHHHHHHHHcccEEccHHHHHHcccEEEEEccHHHHHHHHHHHHHHHcccccEEEEcccccEEccEEEcccccEEEEEccccccHHHHHHHHHccccEEEEEEEEcccccHHHHHHHHHHHcccccHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHcccEEcccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHcccHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccccccc //