[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54333.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:165 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   20->58 PF07673 * DUF1602 1.1e-19 56.4 39/39  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54333.1 GT:GENE BAF54333.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1484947..1485444 GB:FROM 1484947 GB:TO 1485444 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54333.1 LENGTH 165 SQ:AASEQ MLSSWSWSSRRVRASRAPKGSSRSIIGGSMAKARAMPTRCCMPPERRAGRRSAASVRPTCSRWVRVMSARSVLLKEGRAERRPKSMLPRAVNQGRRAWSWKTMPRSGPGPLISSLPALTVPVDGEASPAIILRIVDFPQPEGPRRETNSPSLMVMLVSPMIVVEP GT:EXON 1|1-165:0| SEG 3->17|sswswssrrvrasra| SEG 46->57|rragrrsaasvr| HM:PFM:NREP 1 HM:PFM:REP 20->58|PF07673|1.1e-19|56.4|39/39|DUF1602| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------1-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-29,64-82| PSIPRED cccccccccccccccccccccccccccccccHHHHHHHHHcccccccccEEEcccccccHHHHHHHHHHHHHHHccccHHHccccccEEcccccccccccccccccccccEEEcccccccHHHHHcccccEEEEEEcccccccccccccHHHHHHHHcccEEccc //