[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54334.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  54/68 : Bacteria  723/915 : Eukaryota  7/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:89 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   6->89 2r6gB PDBj 1e-14 42.9 %
:RPS:PDB   8->60 2bbsA PDBj 2e-08 20.8 %
:RPS:PDB   33->89 1cjtC PDBj 1e-15 19.3 %
:RPS:SCOP  6->89 1sgwA  c.37.1.12 * 1e-14 19.3 %
:HMM:SCOP  1->90 1htwA_ c.37.1.18 * 4.5e-21 35.6 %
:HMM:PFM   14->68 PF03193 * DUF258 1.1e-07 22.2 54/161  
:BLT:SWISS 1->56 ARAG_BACHD 8e-06 32.1 %
:BLT:SWISS 32->89 Y4187_BRUSU 3e-17 55.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54334.1 GT:GENE BAF54334.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1485222..1485491) GB:FROM 1485222 GB:TO 1485491 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54334.1 LENGTH 89 SQ:AASEQ MTKPNASVELNAITKSYGSTTIIGDTSITINDGEFVSLLGPSGCGKSTILKMIAGLASPSTGTVSAGNEEIKGPGPDRGMVFQDHALLP GT:EXON 1|1-89:0| BL:SWS:NREP 2 BL:SWS:REP 1->56|ARAG_BACHD|8e-06|32.1|56/517| BL:SWS:REP 32->89|Y4187_BRUSU|3e-17|55.2|58/260| SEG 18->30|gsttiigdtsiti| BL:PDB:NREP 1 BL:PDB:REP 6->89|2r6gB|1e-14|42.9|84/372| RP:PDB:NREP 2 RP:PDB:REP 8->60|2bbsA|2e-08|20.8|53/253| RP:PDB:REP 33->89|1cjtC|1e-15|19.3|57/330| HM:PFM:NREP 1 HM:PFM:REP 14->68|PF03193|1.1e-07|22.2|54/161|DUF258| RP:SCP:NREP 1 RP:SCP:REP 6->89|1sgwA|1e-14|19.3|83/200|c.37.1.12| HM:SCP:REP 1->90|1htwA_|4.5e-21|35.6|90/158|c.37.1.18|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 4106 OP:NHOMOORG 784 OP:PATTERN 553-33--------1-813121239459548211-11211111322211111114554332-1-1-11 -1-19314444-1123333-33113D333331788848BE272934221331235122--2361648654611113111-125----11111-1------------2-1---------------22---2--1-1-44445---63458A7768A883333335898885123-1--13-11-2225533-21133323445346444573221144541231-1111111BB22222212222222211-11332111--22222--11----22---1111111-112222132232211111111111113--111---125234444445323215551221234528111-87-12321-4---2232--22332111-174SVe258F37G7EEDCEBDDDDT-A9L88H9CHi4-pggfaWZwpmbYRH1--ELJFCFGI971-11111163314226-----------------------------3---216QKF9BJKIJB96776GGMR887767FAXD9E9-1AA696956AAJCNR25127348311-1111231134326-1132-16225134--3131-55554817-----1111------------1-----6391322-3-611111-11111121-1111----212------9BFC3A57775766656-7676667666756666667DEDFF2223433333333333333B3435546--6BCBDDDBDDDD----11111222212A5C33353311212322334434-3-1185EDBDCCCD7CEAB88A911111111124335444446567621222221211111---211------------11111112-1-11111111211-211112211411222-42 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----2----------11---------1--1-----2---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED ccccccEEEEEEEEEEEccEEEEEcEEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEcccccccEEEEcccccccc //