[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54337.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:47 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   1->19 PF08464 * Gemini_AC4_5_2 0.00045 52.6 19/43  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54337.1 GT:GENE BAF54337.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1487727..1487870 GB:FROM 1487727 GB:TO 1487870 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54337.1 LENGTH 47 SQ:AASEQ MVRIVRELSRYDLSTAFTLCEHRMTLDYFKAFGTDYALGLAAESEAA GT:EXON 1|1-47:0| HM:PFM:NREP 1 HM:PFM:REP 1->19|PF08464|0.00045|52.6|19/43|Gemini_AC4_5_2| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------1-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,44-48| PSIPRED cHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccEEEEEccccccc //