[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54338.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
e.6.1
:113 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  14->98 1jqiA2 e.6.1.1 * 8.7e-09 28.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54338.1 GT:GENE BAF54338.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1487889..1488230 GB:FROM 1487889 GB:TO 1488230 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54338.1 LENGTH 113 SQ:AASEQ MASAFKEFAGCGEIDLEATRVEGGLKVSGKLRWASNLCEDPVIVPAAKTAEGVQLQSALGAETEGVTLGSSLALLGLNATACAWVSFEDVFIPGAQILSHDFLTLWHRCAQPS GT:EXON 1|1-113:0| SEG 67->80|tlgsslallglnat| HM:SCP:REP 14->98|1jqiA2|8.7e-09|28.2|85/231|e.6.1.1|1/1|Acyl-CoA dehydrogenase NM domain-like| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- -------1111----11-------1------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,113-114| PSIPRED cccHHHHcccccEEEEEEEEEccEEEEEEEEEEEEcccHHEEEEEEEEcccccEEEEEEEcccccEEEcccHHHHEEccccEEEEEEEEEEEcHHHccccccccEEEEccccc //