[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54339.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:123 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   31->114 PF08028 * Acyl-CoA_dh_2 1.2e-05 28.6 84/134  
:BLT:SWISS 23->81 GATC_NITWN 3e-04 36.2 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54339.1 GT:GENE BAF54339.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1488203..1488574 GB:FROM 1488203 GB:TO 1488574 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54339.1 LENGTH 123 SQ:AASEQ MASVRPTFVILQISEYFGVAEAAINAATGRLTSLNEVFIDNAAEIQDNLSSLVALQKDLAQRVNVEGVNPVTPVDLLELRLGSAQLAVAATAIEVRVAGGAGYVKSSSTSRRFRVEMGACTGP GT:EXON 1|1-123:0| BL:SWS:NREP 1 BL:SWS:REP 23->81|GATC_NITWN|3e-04|36.2|58/95| HM:PFM:NREP 1 HM:PFM:REP 31->114|PF08028|1.2e-05|28.6|84/134|Acyl-CoA_dh_2| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,123-124| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHEEEEccccccc //