[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54340.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  210/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
b.45.1
:162 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   12->132 2ecrA PDBj 3e-12 35.7 %
:RPS:PDB   9->159 2d38A PDBj 3e-31 20.0 %
:RPS:SCOP  11->154 1wgbA  b.45.1.2 * 1e-32 25.7 %
:HMM:SCOP  3->163 1uscA_ b.45.1.2 * 1.3e-42 40.6 %
:RPS:PFM   34->154 PF01613 * Flavin_Reduct 9e-13 38.0 %
:HMM:PFM   16->159 PF01613 * Flavin_Reduct 6.4e-35 34.0 144/155  
:BLT:SWISS 11->151 DIM6_STRCO 1e-21 37.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54340.1 GT:GENE BAF54340.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1488698..1489186 GB:FROM 1488698 GB:TO 1489186 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54340.1 LENGTH 162 SQ:AASEQ MTLKTVNGTQLRDTVGSFPSGVTVVTTTDGEVDHGLTVSAFVSLSLEPAMVLVSIDKKSSVVPFLEQGSPVAVSVLSEEQSDLAITFGRHLENKFDGVSIKRSTNRAAVLEGASAWLSGAVVDKYPGGDHFIITIAVEECAHDEEQKPLLYHRGRLFQWQED GT:EXON 1|1-162:0| BL:SWS:NREP 1 BL:SWS:REP 11->151|DIM6_STRCO|1e-21|37.6|141/177| SEG 22->28|vtvvttt| BL:PDB:NREP 1 BL:PDB:REP 12->132|2ecrA|3e-12|35.7|112/149| RP:PDB:NREP 1 RP:PDB:REP 9->159|2d38A|3e-31|20.0|150/156| RP:PFM:NREP 1 RP:PFM:REP 34->154|PF01613|9e-13|38.0|121/150|Flavin_Reduct| HM:PFM:NREP 1 HM:PFM:REP 16->159|PF01613|6.4e-35|34.0|144/155|Flavin_Reduct| RP:SCP:NREP 1 RP:SCP:REP 11->154|1wgbA|1e-32|25.7|144/159|b.45.1.2| HM:SCP:REP 3->163|1uscA_|1.3e-42|40.6|160/178|b.45.1.2|1/1|FMN-binding split barrel| OP:NHOMO 381 OP:NHOMOORG 213 OP:PATTERN -----------------1-----------1-------------------------------------- --1-5--1223---22233-331132333333523274ID-21311-1----331-12--222-4112321-----------2-------------------------1---------------------------11111---11-------------------------------------11-11---2-----------------1----------211--------------------------------------------------------------------------------------------------------------------------------1---------------------1--211--------1--11--------------------------1-1-12221-1111431112--1-1-1--11-------------111111111111---1111111111111------3-1-311112222222111133112211212122322111121111121-131111------1111111----32-----------------------------1--------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------1---------------33323-3---1-----4-2322333-111------------------------11----------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 162 STR:RPRED 100.0 SQ:SECSTR TTcccccGHHHHHHHTTccEEcEEEEEEETTEEEEEEEcccEEEETTTTEEEEEEETTTTTTHHHHTccEEEEEEEccHHHHHHHHHccGcGGGGGcccEEEcGGGcEEETTEEEEEEEEEEEEEEETTEEEEEEEEEEEEcccccccEEEETTEEEEcccc DISOP:02AL 1-6,158-163| PSIPRED cccccccHHHHHHHHHHccccEEEEEEccccEEEEEEEEEEEEEEccccEEEEEEccccHHHHHHHHccEEEEEEccHHHHHHHHHHcccccHHccccEEEEccccccEEcccEEEEEEEEEEEEEcccEEEEEEEEEEEEEcccccccEEEcccccccccc //