[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54350.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  56/68 : Bacteria  561/915 : Eukaryota  178/199 : Viruses  0/175   --->[See Alignment]
d.177.1
:268 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   43->261 2dfuB PDBj 1e-39 43.7 %
:RPS:PDB   1->268 2dfuA PDBj 4e-61 33.3 %
:RPS:SCOP  59->267 1gttA1  d.177.1.1 * 1e-56 27.1 %
:HMM:SCOP  44->266 1nr9A_ d.177.1.1 * 5.9e-61 43.3 %
:RPS:PFM   20->57 PF10370 * DUF2437 8e-04 61.8 %
:RPS:PFM   67->266 PF01557 * FAA_hydrolase 2e-31 43.4 %
:HMM:PFM   62->266 PF01557 * FAA_hydrolase 7.4e-56 42.0 200/217  
:HMM:PFM   1->57 PF10370 * DUF2437 3.9e-20 44.0 50/50  
:BLT:SWISS 42->266 Y2225_ARCFU 1e-48 46.5 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54350.1 GT:GENE BAF54350.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1502021..1502827 GB:FROM 1502021 GB:TO 1502827 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54350.1 LENGTH 268 SQ:AASEQ MRFGRIATPDGMCFCSIEGEGDDVANLTAREIEGTPFTEPKFTGREWPLKDVRLLAPMLPSKVVAIGRNYADHVAEVFKKSAESLPPTLFLKPPTAVTGPESPIRIPSFATKVEFEGELAVVIGKPCKNVKADDWKSVVLGFTIINDVSSRDLQFADGQWARAKGIDTFGPIGPWIETDINSIDLDNLPIKARLTHDGETQLKQDSNSNQMIMKMGEIIEFITASMTLLPGDVIATGSPAGTEAMVHGDYIEIEIPGIGKLGNPVVDA GT:EXON 1|1-268:0| BL:SWS:NREP 1 BL:SWS:REP 42->266|Y2225_ARCFU|1e-48|46.5|215/250| BL:PDB:NREP 1 BL:PDB:REP 43->261|2dfuB|1e-39|43.7|199/249| RP:PDB:NREP 1 RP:PDB:REP 1->268|2dfuA|4e-61|33.3|246/251| RP:PFM:NREP 2 RP:PFM:REP 20->57|PF10370|8e-04|61.8|34/51|DUF2437| RP:PFM:REP 67->266|PF01557|2e-31|43.4|196/213|FAA_hydrolase| HM:PFM:NREP 2 HM:PFM:REP 62->266|PF01557|7.4e-56|42.0|200/217|FAA_hydrolase| HM:PFM:REP 1->57|PF10370|3.9e-20|44.0|50/50|DUF2437| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF01557|IPR002529| GO:PFM GO:0008152|"GO:metabolic process"|PF01557|IPR002529| RP:SCP:NREP 1 RP:SCP:REP 59->267|1gttA1|1e-56|27.1|199/213|d.177.1.1| HM:SCP:REP 44->266|1nr9A_|5.9e-61|43.3|217/221|d.177.1.1|1/1|FAH| OP:NHOMO 1853 OP:NHOMOORG 795 OP:PATTERN 11---12444444442-212111231122153-1111111111-----111111111-1112211-11 2231431222221253222-21113522222123433299221525211222795233--113122435211111111----5-11--11111111---11221231213---------------11-11-1--112-12211123-111111----------1111111--------1----2222211-21122222222422322233111122215513111111112411111111111111111111-----------11--11-----------------------------------------------------12--1-----------211---------2---1221---1-1112111--1-27111-1--132A771135344333333332332-33633534723-533723433322855313643233244--------221-3412-----------------------------2-3F2-8763678A6752444277754445-564G3A6625443334225672B5331----111111111---211121--1-1-21111111111111-111113-11--1111111--1---------11-11--11111-21--111111----11---111----11-------32221211221111122-2212111211212221223322223214242434444434324422122221-122233323333---1---------11125--------------1111111111212444443261232111221----------111--------121122222222-------1----11--------------------------------------1--------11 ----222-21--1113443755398872222222213333333222434977ED445433332131111-111131111112222211-22242223222212211-111424212211--12-221217F4-32312113-231--1--2-1212214322134423233112211117111-121322221211222 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 259 STR:RPRED 96.6 SQ:SECSTR cEEEEETTTE#########HTccEEEEETTEEEEEccTTccEEEEEEEGGGccEEcccccccEEEEcccccccccccEEEEcGGEGGEEccccTTcHHHHcccEEEccccccEEccEEEEEEEccccccccHHHHGGGEEEEEEEEccEEHHHHHHccccHHHHccTTcEEEEEEEEccTTcccTTccEEEEEEEETTEEcEEEEEEGGGccccHHHHHHHHHTTccccTTcEEEcccccccccccTTcEEEEEETTTEEEEEEEEEE DISOP:02AL 268-269| PSIPRED cEEEEEEEccEEEEEEEEcccccHHHHHHHcccccccccccccccEEEccccEEEcccccccEEEEEccHHHHHHHHccccccccccEEEEcccccEEcccccEEcccccccccccEEEEEEEccccccccHHHHHHHHHEEEEEEEccHHHHHHcccccEEEcccccccccccEEccHHHcccccccEEEEEEEEEEccEEEEcccHHHccccHHHHHHHHHccEEEccccEEEEcccccccccccccEEEEEEcccEEEEEEEEcc //